SimulationCraft has not been built with PTR data.  The 'ptr=' option is ignored.
close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 38.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

1ilevel : 1085268 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1085268.3 1085268.3 867.7 / 0.080% 159331.5 / 14.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
1ilevel 1085268
Earth Shock 104261 9.6% 16.4 17.63sec 1907763 1971080 Direct 16.4 1347264 3733270 1907857 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.39 16.39 0.00 0.00 0.9679 0.0000 31269209.60 31269209.60 0.00 1971079.78 1971079.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.54 76.51% 1347264.36 1139446 1574918 1347621.11 1241972 1466357 16895130 16895130 0.00
crit 3.85 23.49% 3733270.29 3153985 4359374 3679461.80 0 4359374 14374080 14374080 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60356 (92409) 5.6% (8.5%) 22.1 13.76sec 1254592 946609 Direct 22.0 584379 1617789 821495 22.9%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.03 0.00 0.00 1.3254 0.0000 18096957.40 18096957.40 0.00 946608.64 946608.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.98 77.06% 584378.82 523267 642246 584545.18 559584 612379 9920615 9920615 0.00
crit 5.05 22.94% 1617789.38 1448404 1777736 1610508.50 0 1777736 8176342 8176342 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 32053 3.0% 14.0 21.16sec 687221 0 Direct 14.0 490960 1358808 689053 22.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.95 0.00 0.00 0.0000 0.0000 9613117.22 9613117.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.77 77.18% 490959.60 439545 539486 491072.13 449333 526566 5286394 5286394 0.00
crit 3.18 22.82% 1358807.84 1216660 1493298 1313222.14 0 1493298 4326723 4326723 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 121450 11.2% 11.2 27.77sec 3236787 3371483 Direct 11.2 86771 243922 203416 74.2%  
Periodic 236.3 47763 182303 144055 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.31 236.31 0.9601 1.2619 36324358.78 36324358.78 0.00 117563.69 3371483.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.89 25.78% 86770.93 78137 95903 85768.20 0 95903 251008 251008 0.00
crit 8.33 74.22% 243922.50 216282 265459 243968.08 229617 257102 2031773 2031773 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.2 28.43% 47762.73 61 52748 47756.87 44233 50011 3208454 3208454 0.00
crit 169.1 71.57% 182302.83 372 204407 182403.17 170933 190888 30833125 30833125 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 118584 10.9% 38.3 7.54sec 927262 970356 Direct 38.3 654875 1813806 927283 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.33 38.33 0.00 0.00 0.9556 0.0000 35537351.98 35537351.98 0.00 970356.11 970356.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.32 76.50% 654874.65 510103 726536 655185.08 627397 690638 19199470 19199470 0.00
crit 9.01 23.50% 1813806.29 1638501 2011051 1813401.28 1638501 2011051 16337882 16337882 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 33893 (52029) 3.1% (4.8%) 9.7 32.15sec 1609849 1264062 Direct 9.7 742970 2059340 1050962 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.66 0.00 0.00 1.2736 0.0000 10155947.29 10155947.29 0.00 1264062.09 1264062.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.40 76.60% 742969.85 665924 817339 743182.66 665924 809183 5499548 5499548 0.00
crit 2.26 23.40% 2059339.85 1843278 2262394 1899868.79 0 2262394 4656400 4656400 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18137 1.7% 6.2 47.31sec 878615 0 Direct 6.2 624138 1729312 880366 23.2%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.19 6.18 0.00 0.00 0.0000 0.0000 5436258.56 5436258.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.74 76.82% 624137.79 559376 686565 623524.16 0 686565 2960769 2960769 0.00
crit 1.43 23.18% 1729312.38 1548354 1900411 1350068.34 0 1900411 2475489 2475489 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 150255 (235556) 13.9% (21.7%) 59.0 5.04sec 1196913 1025746 Direct 58.9 0 765259 765259 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.02 58.88 0.00 0.00 1.1669 0.0000 45058286.43 45058286.43 0.00 1025745.87 1025745.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.88 100.00% 765259.28 695280 853369 765378.52 740799 790194 45058286 45058286 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77142 7.1% 37.5 7.89sec 616363 0 Direct 37.4 0 618228 618228 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.54 37.43 0.00 0.00 0.0000 0.0000 23137972.11 23137972.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.43 100.00% 618228.23 561738 689462 618324.57 595565 642924 23137972 23137972 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8159 0.8% 43.9 6.21sec 55730 0 Direct 43.9 44874 91542 55728 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.91 43.91 0.00 0.00 0.0000 0.0000 2446859.68 2446859.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.69 76.74% 44873.78 43108 48099 44884.08 43358 47139 1511905 1511905 0.00
crit 10.21 23.26% 91542.30 87940 98122 91541.48 0 98122 934955 934955 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103637 (189679) 9.6% (17.5%) 96.2 3.03sec 590664 491754 Direct 96.2 228053 634829 322700 23.3%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.23 96.23 0.00 0.00 1.2011 0.0000 31054801.67 31054801.67 0.00 491753.90 491753.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.84 76.73% 228053.03 154866 570234 228290.51 194899 262172 16838678 16838678 0.00
crit 22.39 23.27% 634829.40 428668 1578408 635100.49 460529 968887 14216123 14216123 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 86042 7.9% 93.7 3.79sec 275105 0 Direct 93.7 194657 540773 275110 23.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.72 93.72 0.00 0.00 0.0000 0.0000 25784081.67 25784081.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.94 76.76% 194656.88 130087 478997 194743.50 152438 257148 14003898 14003898 0.00
crit 21.78 23.24% 540772.58 360081 1325862 540851.45 388528 878125 11780184 11780184 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59603) 0.0% (5.5%) 3.0 120.37sec 5946286 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.85 0.00 0.0000 1.0000 0.00 0.00 0.00 306757.64 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19073 1.7% 37.7 6.96sec 150743 0 Direct 37.5 121869 248614 151346 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.67 37.52 0.00 0.00 0.0000 0.0000 5678285.68 5678285.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.79 76.75% 121869.49 121869 121869 121869.49 121869 121869 3509140 3509140 0.00
crit 8.72 23.25% 248613.77 248614 248614 248613.77 248614 248614 2169146 2169146 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40529 3.7% 98.9 2.62sec 122069 0 Direct 98.6 98655 201256 122382 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.85 98.60 0.00 0.00 0.0000 0.0000 12066723.60 12066723.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.80 76.87% 98654.92 98655 98655 98654.92 98655 98655 7477773 7477773 0.00
crit 22.80 23.13% 201256.04 201256 201256 201256.04 201256 201256 4588951 4588951 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 137063 / 85006
Fire Blast 137063 7.8% 98.0 2.96sec 258717 139500 Direct 98.0 210183 420441 258717 23.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.03 98.03 0.00 0.00 1.8546 0.0000 25362207.90 25362207.90 0.00 139499.96 139499.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.40 76.92% 210182.61 199777 222910 210226.76 205730 216805 15848124 15848124 0.00
crit 22.63 23.08% 420441.41 399554 445820 420540.89 405701 437042 9514084 9514084 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 187122 / 26692
Lightning Blast 187122 2.5% 42.1 6.69sec 189805 202999 Direct 42.1 154163 308399 189798 23.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.09 42.09 0.00 0.00 0.9350 0.0000 7988201.41 7988201.41 0.00 202998.69 202998.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.36 76.89% 154162.84 147983 165119 154198.62 149565 161792 4988825 4988825 0.00
crit 9.73 23.11% 308398.90 295966 330237 308415.86 0 330237 2999376 2999376 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
1ilevel
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:1ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.67sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0231 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:1ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:1ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.56sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 0.00 0.00 0.8211 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.05sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5214 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.1sec 32.16% 32.16% 3.1(3.1) 7.9

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 68.6sec 68.6sec 8.69% 8.69% 0.0(0.0) 3.2

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.69%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.7sec 34.82% 34.82% 1.4(1.4) 10.2

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.1sec 23.6sec 34.93% 34.93% 1.4(1.4) 10.2

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.9sec 23.5sec 33.93% 33.93% 1.8(1.8) 9.9

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.9 26.6 4.2sec 3.0sec 59.22% 61.26% 26.6(32.6) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.65%
  • elemental_focus_2:33.57%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.68% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.44%
  • icefury_2:5.97%
  • icefury_3:5.01%
  • icefury_4:3.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.4 13.0sec 12.2sec 10.39% 39.68% 1.4(1.4) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.39%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.0sec 29.96% 29.96% 4.2(4.2) 12.7

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 68.9sec 68.9sec 13.49% 13.49% 0.0(0.0) 3.3

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.49%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.1sec 0.0sec 39.91% 39.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.4 1.4 36.8sec 30.3sec 21.85% 24.07% 1.4(2.9) 0.1

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.15%
  • power_of_the_maelstrom_2:6.35%
  • power_of_the_maelstrom_3:9.35%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.48% 8.93% 0.0(0.0) 0.2

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.28%
  • stormkeeper_2:3.66%
  • stormkeeper_3:4.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 78.4sec
Lava Surge: During Lava Burst 3.7 58.0sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6860.0014.9262.4800.0008.345
Fire Elemental0.5050.0011.6580.5620.0003.774
Lava Burst0.9120.0019.5127.4940.00028.215
Elemental Blast0.5400.0015.3218.9802.71119.257
Icefury1.0150.0018.3377.3890.44828.072

Resources

Resource Usage Type Count Total Average RPE APR
1ilevel
earth_shock Maelstrom 132.7 15923.4 120.0 971.5 1963.7
flame_shock Maelstrom 90.9 1622.6 17.9 144.6 22386.2
frost_shock Maelstrom 310.4 6207.7 20.0 162.0 5724.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 477.98 5674.07 (23.46%) 11.87 61.75 1.08%
Lava Burst Overload Maelstrom 304.00 2636.36 (10.90%) 8.67 99.65 3.64%
Lightning Bolt Maelstrom 779.32 6218.12 (25.71%) 7.98 16.48 0.26%
Lightning Bolt Overload Maelstrom 759.05 4501.82 (18.61%) 5.93 52.49 1.15%
Icefury Maelstrom 78.44 1871.20 (7.74%) 23.85 11.39 0.61%
Icefury Overload Maelstrom 50.11 892.01 (3.69%) 17.80 9.92 1.10%
Resonance Totem Maelstrom 2417.18 2394.19 (9.90%) 0.99 22.99 0.95%
Resource RPS-Gain RPS-Loss
Maelstrom 9.96 9.78
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 52.87 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 1ilevel Fight Length
Count 8617
Mean 300.01
Minimum 239.94
Maximum 360.04
Spread ( max - min ) 120.10
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 36.0022
5th Percentile 246.16
95th Percentile 353.82
( 95th Percentile - 5th Percentile ) 107.65
Mean Distribution
Standard Deviation 0.3878
95.00% Confidence Intervall ( 299.24 - 300.77 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 554
0.1% Error 55322
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1107
DPS
Sample Data 1ilevel Damage Per Second
Count 8617
Mean 1085268.28
Minimum 956843.66
Maximum 1249138.39
Spread ( max - min ) 292294.74
Range [ ( max - min ) / 2 * 100% ] 13.47%
Standard Deviation 41095.6655
5th Percentile 1020174.38
95th Percentile 1156480.21
( 95th Percentile - 5th Percentile ) 136305.83
Mean Distribution
Standard Deviation 442.7086
95.00% Confidence Intervall ( 1084400.59 - 1086135.97 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5509
0.1 Scale Factor Error with Delta=300 14417027
0.05 Scale Factor Error with Delta=300 57668108
0.01 Scale Factor Error with Delta=300 1441702677
Priority Target DPS
Sample Data 1ilevel Priority Target Damage Per Second
Count 8617
Mean 1085268.28
Minimum 956843.66
Maximum 1249138.39
Spread ( max - min ) 292294.74
Range [ ( max - min ) / 2 * 100% ] 13.47%
Standard Deviation 41095.6655
5th Percentile 1020174.38
95th Percentile 1156480.21
( 95th Percentile - 5th Percentile ) 136305.83
Mean Distribution
Standard Deviation 442.7086
95.00% Confidence Intervall ( 1084400.59 - 1086135.97 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5509
0.1 Scale Factor Error with Delta=300 14417027
0.05 Scale Factor Error with Delta=300 57668108
0.01 Scale Factor Error with Delta=300 1441702677
DPS(e)
Sample Data 1ilevel Damage Per Second (Effective)
Count 8617
Mean 1085268.28
Minimum 956843.66
Maximum 1249138.39
Spread ( max - min ) 292294.74
Range [ ( max - min ) / 2 * 100% ] 13.47%
Damage
Sample Data 1ilevel Damage
Count 8617
Mean 291660211.68
Minimum 210875324.89
Maximum 381224158.03
Spread ( max - min ) 170348833.15
Range [ ( max - min ) / 2 * 100% ] 29.20%
DTPS
Sample Data 1ilevel Damage Taken Per Second
Count 8617
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 1ilevel Healing Per Second
Count 8617
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 1ilevel Healing Per Second (Effective)
Count 8617
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 1ilevel Heal
Count 8617
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 1ilevel Healing Taken Per Second
Count 8617
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 1ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 1ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 1ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.01 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.18 totem_mastery,if=buff.resonance_totem.remains<2
9 3.41 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.01 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.51 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.43 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.37 elemental_blast
Keep your EB always on Cooldown.
I 12.31 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.45 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.81 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.57 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 59.66 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.21 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.80 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.21 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.04 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.81 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 73.95 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNNMSOSSSMSHSSSIMSMSSMSIHSMMSSKNNNMNOSHSSMSSISSSMHSSSJMIMKNNHMNNOSSMSSSHSMMISSSMSSHKNNMN97NFSSMHQSSSMIMAMJSSHMSOKGGMGMMGHPRRMRSSSIHMSSSSMKGNNFHMNSMSSMSISHJMMMLLILMMKHFMMMGNNNRMR9HMIMMRROSSMHQSIKMMMNNNNHMRARRSJMSIMSMOSHSSMMSSIKMMHNNNSSNSMMRRRHIMMOSSSSMSHIKMMMN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 1ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 1ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 1ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.873 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.939 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.956 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.971 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.726 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:06.481 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:07.236 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:07.991 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.743 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:09.497 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:10.252 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:11.008 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:11.763 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:12.517 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:13.271 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:14.026 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:14.780 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:15.692 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:16.447 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:17.202 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:18.420 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:19.336 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:20.251 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:21.469 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:22.689 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:23.906 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:25.125 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.905 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.992 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.808 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.895 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.980 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.018 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.797 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.834 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.870 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.986 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:35.765 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:36.543 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:37.321 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:38.357 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:39.135 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.914 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.000 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.411 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.758 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.104 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:46.423 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:47.742 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:49.063 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:50.055 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:51.376 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.723 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.136 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:55.521 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.903 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.286 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
0:59.670 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.054 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:02.092 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:03.476 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.514 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.553 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:06.935 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:07.993 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:09.053 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:10.467 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:11.877 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:12.935 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:13.996 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.055 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.115 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.175 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.586 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.997 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:21.408 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.820 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:24.231 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:25.643 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.990 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.000 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.010 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.355 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.702 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.049 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.394 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.740 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.152 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.563 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.911 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:40.922 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:41.933 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:43.280 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:44.290 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:45.301 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:45.301 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:46.312 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.322 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.668 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.013 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.425 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.836 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.591 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.937 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.282 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.628 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.637 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.646 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.966 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.966 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.958 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.079 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.118 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.157 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.539 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:07.924 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.962 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.000 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.411 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:12.471 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:13.530 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:14.590 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:15.648 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:16.707 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:18.119 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
2:19.178 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:20.562 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:21.600 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:22.984 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:24.369 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:25.782 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:27.194 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.604 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.019 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.430 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:32.490 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:33.970 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:35.290 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:36.610 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:37.931 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:39.252 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:40.573 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:41.920 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:43.266 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:44.275 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:45.332 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:46.393 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:47.454 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:48.866 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:50.279 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:51.339 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.750 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.809 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.221 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.606 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.989 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.373 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.411 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.796 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.208 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.266 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.278 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.290 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.638 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.648 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.658 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.669 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.678 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.689 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.034 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.446 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:16.856 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:17.867 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:18.877 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:20.223 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:21.232 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:22.242 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:23.251 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:24.262 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
3:25.273 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.619 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.967 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.379 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.437 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.850 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.859 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.870 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.217 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.228 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:37.549 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:38.869 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:39.860 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:41.180 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:42.502 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:43.913 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:45.325 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:46.079 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:47.491 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:48.530 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:49.913 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:50.952 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:52.336 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:53.375 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:54.435 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:55.494 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:56.531 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:57.569 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.954 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.338 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:01.301 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:01.301 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:02.285 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:03.270 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:04.252 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:05.019 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:05.774 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:06.530 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:07.285 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:08.267 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:09.024 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:09.779 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:10.532 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:11.287 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:12.269 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:13.205 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:14.787 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
4:15.952 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:17.506 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:19.059 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:20.612 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:21.368 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:22.304 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
4:23.058 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
4:24.040 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
4:25.246 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
4:26.001 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
4:26.755 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:27.510 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
4:28.493 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
4:29.475 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
4:30.229 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:31.211 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:31.965 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:32.947 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:34.608 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:36.270 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:37.929 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:39.591 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:40.778 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.787 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.135 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.144 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.491 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:46.837 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.185 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.530 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.877 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.288 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.699 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.710 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.056 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:57.067 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:58.413 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:59.423 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81663 81663 44193
Intellect 58940 56709 46683 (20870)
Spirit 0 0 0
Health 4899780 4899780 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58940 56709 0
Crit 20.31% 20.31% 6125
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7245
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 955, weapon: { 4382 - 8141, 2.6 }, stats: { +1552 Int, +2329 Sta, +442 Crit, +424 Mastery, +19759 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 955, stats: { +2038 Int, +3057 Sta, +580 Crit, +557 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="1ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,ilevel=955
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.75
# gear_stamina=44193
# gear_intellect=46683
# gear_crit_rating=6125
# gear_haste_rating=11779
# gear_mastery_rating=7245
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

2ilevel : 1090063 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1090063.3 1090063.3 871.2 / 0.080% 161917.7 / 14.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
2ilevel 1090063
Earth Shock 104743 9.6% 16.4 17.60sec 1914957 1977153 Direct 16.4 1352971 3746238 1914933 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.40 16.40 0.00 0.00 0.9686 0.0000 31409057.67 31409057.67 0.00 1977153.32 1977153.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.55 76.52% 1352970.63 1143795 1580306 1353392.51 1247374 1464495 16980281 16980281 0.00
crit 3.85 23.48% 3746238.26 3166026 4374288 3693051.52 0 4374288 14428776 14428776 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60853 (93152) 5.6% (8.6%) 22.1 13.76sec 1264370 953906 Direct 22.0 586617 1624402 827844 23.2%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.04 0.00 0.00 1.3255 0.0000 18242347.17 18242347.17 0.00 953905.91 953905.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.91 76.75% 586617.49 525265 644443 586782.82 560623 610173 9921182 9921182 0.00
crit 5.12 23.25% 1624402.14 1453933 1783818 1620229.72 0 1783818 8321165 8321165 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 32299 3.0% 14.0 21.10sec 692314 0 Direct 14.0 492879 1363696 694103 23.1%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.95 0.00 0.00 0.0000 0.0000 9683248.42 9683248.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.73 76.89% 492878.69 441223 541332 493016.43 441223 526259 5287325 5287325 0.00
crit 3.22 23.11% 1363696.22 1221304 1498407 1318657.65 0 1498407 4395923 4395923 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 121980 11.2% 11.2 27.77sec 3253053 3390827 Direct 11.2 87038 244894 204334 74.3%  
Periodic 236.4 47954 182971 144637 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 236.38 236.38 0.9595 1.2615 36481910.80 36481910.80 0.00 118077.43 3390827.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.88 25.69% 87038.31 78435 96231 86120.07 0 96231 250748 250748 0.00
crit 8.33 74.31% 244893.53 217108 266367 244949.48 231390 256770 2040881 2040881 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.1 28.39% 47953.82 31 52928 47943.56 43929 50045 3218192 3218192 0.00
crit 169.3 71.61% 182970.76 72 205106 183070.97 172911 191918 30972090 30972090 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 119113 10.9% 38.3 7.55sec 931549 975206 Direct 38.3 657247 1819975 931563 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.33 38.33 0.00 0.00 0.9552 0.0000 35704224.65 35704224.65 0.00 975205.52 975205.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.29 76.41% 657246.68 558510 729022 657524.90 626005 692613 19247771 19247771 0.00
crit 9.04 23.59% 1819975.05 1644756 2017932 1819206.60 0 1997864 16456454 16456454 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 34098 (52379) 3.1% (4.8%) 9.7 32.16sec 1620838 1274103 Direct 9.7 745689 2066876 1057238 23.6%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2722 0.0000 10220245.19 10220245.19 0.00 1274103.49 1274103.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.39 76.42% 745689.28 668466 820135 745899.27 691326 798930 5508843 5508843 0.00
crit 2.28 23.58% 2066876.25 1850315 2270134 1912818.54 0 2270134 4711402 4711402 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18281 1.7% 6.2 46.75sec 884317 0 Direct 6.2 626606 1735908 886043 23.4%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.20 6.19 0.00 0.00 0.0000 0.0000 5480532.09 5480532.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.74 76.61% 626606.42 561512 688913 626412.85 0 688913 2969243 2969243 0.00
crit 1.45 23.39% 1735907.72 1554264 1906912 1373698.49 0 1906912 2511289 2511289 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 150795 (236422) 13.9% (21.7%) 59.0 5.04sec 1201558 1029672 Direct 58.9 0 768251 768251 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.00 58.85 0.00 0.00 1.1669 0.0000 45215128.56 45215128.56 0.00 1029671.94 1029671.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.85 100.00% 768250.76 697935 856289 768374.73 745764 793687 45215129 45215129 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77468 7.1% 37.6 7.82sec 618660 0 Direct 37.4 0 620702 620702 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.55 37.43 0.00 0.00 0.0000 0.0000 23231450.73 23231450.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.43 100.00% 620702.29 563882 691821 620801.88 600682 647164 23231451 23231451 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8159 0.7% 43.8 6.26sec 55900 0 Direct 43.8 45045 91902 55901 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.76 43.76 0.00 0.00 0.0000 0.0000 2446333.69 2446333.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.62 76.83% 45044.85 43272 48263 45052.98 43447 47432 1514579 1514579 0.00
crit 10.14 23.17% 91902.22 88276 98457 91890.56 0 98457 931754 931754 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103943 (190516) 9.5% (17.5%) 96.3 3.04sec 592922 493775 Direct 96.3 228950 635871 323497 23.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.28 96.28 0.00 0.00 1.2008 0.0000 31147581.69 31147581.69 0.00 493774.76 493774.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.91 76.77% 228949.91 155457 572185 229186.74 195728 272275 16922866 16922866 0.00
crit 22.37 23.23% 635870.92 430304 1583808 636100.86 459445 1049573 14224715 14224715 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 86574 7.9% 93.9 3.79sec 276182 0 Direct 93.9 195526 543616 276175 23.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.93 93.93 0.00 0.00 0.0000 0.0000 25941668.75 25941668.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.16 76.83% 195526.19 130584 480635 195582.49 154554 247104 14110451 14110451 0.00
crit 21.76 23.17% 543615.97 361456 1330399 543832.27 383647 868214 11831217 11831217 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59499) 0.0% (5.4%) 3.0 120.38sec 5932350 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.72 0.00 0.0000 1.0000 0.00 0.00 0.00 306915.39 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19036 1.7% 37.6 6.95sec 150730 0 Direct 37.4 121869 248614 151351 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.60 37.44 0.00 0.00 0.0000 0.0000 5666928.05 5666928.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.73 76.74% 121869.49 121869 121869 121869.49 121869 121869 3501766 3501766 0.00
crit 8.71 23.26% 248613.77 248614 248614 248555.60 0 248614 2165162 2165162 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40463 3.7% 98.7 2.62sec 122052 0 Direct 98.5 98655 201256 122366 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.71 98.46 0.00 0.00 0.0000 0.0000 12048228.44 12048228.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.71 76.89% 98654.92 98655 98655 98654.92 98655 98655 7468782 7468782 0.00
crit 22.75 23.11% 201256.04 201256 201256 201256.04 201256 201256 4579446 4579446 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 137774 / 85456
Fire Blast 137774 7.8% 98.1 2.95sec 259878 140207 Direct 98.1 210961 422051 259875 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.11 98.11 0.00 0.00 1.8535 0.0000 25497563.37 25497563.37 0.00 140206.66 140206.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.38 76.83% 210961.02 200540 223673 211008.69 206038 218388 15901653 15901653 0.00
crit 22.74 23.17% 422051.02 401079 447346 422133.82 409134 439338 9595911 9595911 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 188338 / 26802
Lightning Blast 188338 2.5% 42.1 6.73sec 190776 204234 Direct 42.1 154771 309596 190774 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.05 42.05 0.00 0.00 0.9341 0.0000 8022307.91 8022307.91 0.00 204233.91 204233.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.27 76.75% 154770.68 148548 165684 154802.26 150379 161786 4994781 4994781 0.00
crit 9.78 23.25% 309596.16 297096 331367 309643.92 0 331367 3027527 3027527 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
2ilevel
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:2ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.50sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0218 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:2ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:2ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.59sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8210 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.04sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5217 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 24.9sec 32.34% 32.34% 3.1(3.1) 8.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.75% 8.75% 0.0(0.0) 3.2

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.75%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.6sec 34.90% 34.90% 1.4(1.4) 10.2

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.90% 34.90% 1.4(1.4) 10.2

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.0sec 23.5sec 33.79% 33.79% 1.8(1.8) 9.9

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.9 26.6 4.2sec 3.0sec 59.26% 61.28% 26.6(32.6) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.67%
  • elemental_focus_2:33.59%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.63% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.43%
  • icefury_2:5.92%
  • icefury_3:5.02%
  • icefury_4:3.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.4 13.0sec 12.2sec 10.36% 39.66% 1.4(1.4) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.36%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.93% 29.93% 4.2(4.2) 12.6

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.2sec 69.2sec 13.60% 13.60% 0.0(0.0) 3.3

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.60%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.1sec 0.0sec 39.92% 39.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.6sec 30.1sec 21.89% 24.17% 1.4(3.0) 0.1

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.11%
  • power_of_the_maelstrom_2:6.35%
  • power_of_the_maelstrom_3:9.42%

Trigger Attempt Success

  • trigger_pct:15.14%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.46% 8.91% 0.0(0.0) 0.2

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.27%
  • stormkeeper_2:3.67%
  • stormkeeper_3:4.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 79.4sec
Lava Surge: During Lava Burst 3.6 58.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6880.0014.5722.4850.0009.470
Fire Elemental0.5000.0011.8510.5470.0003.434
Lava Burst0.9090.0018.9067.4330.00025.119
Elemental Blast0.5410.0014.4258.9742.67717.767
Icefury1.0160.0018.8447.4320.67522.563

Resources

Resource Usage Type Count Total Average RPE APR
2ilevel
earth_shock Maelstrom 128.9 15461.0 120.0 942.6 2031.5
flame_shock Maelstrom 88.1 1572.9 17.9 140.3 23193.8
frost_shock Maelstrom 301.1 6022.8 20.0 157.1 5928.2
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 463.56 5503.36 (23.44%) 11.87 59.37 1.07%
Lava Burst Overload Maelstrom 295.03 2559.18 (10.90%) 8.67 96.11 3.62%
Lightning Bolt Maelstrom 756.47 6035.97 (25.71%) 7.98 15.82 0.26%
Lightning Bolt Overload Maelstrom 737.98 4375.76 (18.64%) 5.93 52.12 1.18%
Icefury Maelstrom 76.11 1815.44 (7.73%) 23.85 11.19 0.61%
Icefury Overload Maelstrom 48.70 866.72 (3.69%) 17.80 9.81 1.12%
Resonance Totem Maelstrom 2345.05 2322.69 (9.89%) 0.99 22.36 0.95%
Resource RPS-Gain RPS-Loss
Maelstrom 9.96 9.78
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.46 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 2ilevel Fight Length
Count 8548
Mean 300.01
Minimum 239.99
Maximum 360.04
Spread ( max - min ) 120.04
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 36.3073
5th Percentile 245.71
95th Percentile 354.34
( 95th Percentile - 5th Percentile ) 108.63
Mean Distribution
Standard Deviation 0.3927
95.00% Confidence Intervall ( 299.24 - 300.78 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 563
0.1% Error 56262
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 46
0.01 Scale Factor Error with Delta=300 1126
DPS
Sample Data 2ilevel Damage Per Second
Count 8548
Mean 1090063.31
Minimum 928207.39
Maximum 1259147.48
Spread ( max - min ) 330940.09
Range [ ( max - min ) / 2 * 100% ] 15.18%
Standard Deviation 41096.1136
5th Percentile 1024679.62
95th Percentile 1161020.83
( 95th Percentile - 5th Percentile ) 136341.21
Mean Distribution
Standard Deviation 444.4967
95.00% Confidence Intervall ( 1089192.11 - 1090934.51 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5461
0.1 Scale Factor Error with Delta=300 14417342
0.05 Scale Factor Error with Delta=300 57669365
0.01 Scale Factor Error with Delta=300 1441734119
Priority Target DPS
Sample Data 2ilevel Priority Target Damage Per Second
Count 8548
Mean 1090063.31
Minimum 928207.39
Maximum 1259147.48
Spread ( max - min ) 330940.09
Range [ ( max - min ) / 2 * 100% ] 15.18%
Standard Deviation 41096.1136
5th Percentile 1024679.62
95th Percentile 1161020.83
( 95th Percentile - 5th Percentile ) 136341.21
Mean Distribution
Standard Deviation 444.4967
95.00% Confidence Intervall ( 1089192.11 - 1090934.51 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5461
0.1 Scale Factor Error with Delta=300 14417342
0.05 Scale Factor Error with Delta=300 57669365
0.01 Scale Factor Error with Delta=300 1441734119
DPS(e)
Sample Data 2ilevel Damage Per Second (Effective)
Count 8548
Mean 1090063.31
Minimum 928207.39
Maximum 1259147.48
Spread ( max - min ) 330940.09
Range [ ( max - min ) / 2 * 100% ] 15.18%
Damage
Sample Data 2ilevel Damage
Count 8548
Mean 292918885.89
Minimum 197878074.47
Maximum 383430881.23
Spread ( max - min ) 185552806.76
Range [ ( max - min ) / 2 * 100% ] 31.67%
DTPS
Sample Data 2ilevel Damage Taken Per Second
Count 8548
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 2ilevel Healing Per Second
Count 8548
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 2ilevel Healing Per Second (Effective)
Count 8548
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 2ilevel Heal
Count 8548
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 2ilevel Healing Taken Per Second
Count 8548
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 2ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 2ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 2ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.18 totem_mastery,if=buff.resonance_totem.remains<2
9 3.38 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.99 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.46 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.43 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.19 elemental_blast
Keep your EB always on Cooldown.
I 12.25 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.41 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.73 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.64 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 59.16 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.89 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.76 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.15 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.02 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.66 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 73.32 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNNSSSSSMMHPFSSSSSSMSPSMOSHSMMSSSIKNSMNHMNNSMSSMRMHMIRJLFMSSSHSMIKNNSNMMHNSSMOSSSSMIMHSSSSM97MRIKHMMNNNNQRMMORAJHSSISSMSSSSHMPSKNNNSMNSSSHMOMSSSSMIHSSSMRKNNNNHMRORSJMMPSHSSSMSSSISKHMMMGNNNORRMRSIHSM9SSSSMQHSPKNMNNSSAFHJMNSSMSMSSHISMSSSKMGGHFNNMRRRSISMHSSSSSSIMSOSMHK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 2ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 2ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 2ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.939 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.004 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.068 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.132 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.933 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.732 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:08.531 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:09.329 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:10.127 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:10.927 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:11.725 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:12.791 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:13.546 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:14.299 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:15.052 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:15.805 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:16.560 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:17.316 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:18.074 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:18.831 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:19.587 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:20.344 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:21.099 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:21.855 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:22.611 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:23.366 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:24.120 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:24.874 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:25.816 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:26.757 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:28.011 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:29.263 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:30.459 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:31.356 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:32.551 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:33.745 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.762 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.779 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:36.542 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.558 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:38.321 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:39.336 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:40.353 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:41.152 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
0:42.643 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:43.654 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:44.665 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:45.675 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.022 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.368 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.715 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.062 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.072 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:53.392 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:54.431 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.021 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:57.404 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.442 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
0:59.824 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.060 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.099 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.139 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.523 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.561 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:06.601 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.985 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.430 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.842 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.253 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.314 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.725 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:15.784 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:16.843 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:18.227 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:19.266 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:20.651 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:21.691 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:23.075 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:24.113 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.495 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.878 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.289 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:29.327 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:30.290 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:31.251 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:32.213 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:33.177 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:33.931 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:34.685 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:35.649 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:36.613 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:37.575 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:38.537 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:39.519 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:40.501 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:41.253 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:42.500 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:42.500 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:44.163 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:45.824 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:47.068 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:48.728 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
1:50.138 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
1:51.198 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
1:52.609 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
1:53.647 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
1:54.685 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:55.441 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:56.195 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:56.949 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:57.910 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:58.665 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:59.647 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:00.401 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:01.382 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:01.382 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:02.136 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:03.098 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:03.854 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:04.609 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:05.363 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:06.117 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
2:07.745 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
2:09.372 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:11.034 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:12.695 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
2:14.324 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:15.285 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:16.248 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:17.210 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:17.965 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:18.883 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
2:19.820 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
2:20.574 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
2:21.329 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
2:22.082 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
2:23.018 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
2:23.955 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
2:24.710 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:25.647 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:26.583 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:28.169 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:29.903 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:31.150 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:32.337 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:33.922 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:35.269 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:36.615 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:37.961 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:39.305 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:40.651 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:41.710 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:43.310 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:44.656 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:45.978 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:47.299 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.620 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:49.939 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:51.259 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:52.268 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:53.279 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
2:54.269 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
2:55.306 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.690 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:58.012 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.333 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.344 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.691 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.039 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.050 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.062 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.408 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:07.399 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:08.438 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:10.067 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:11.059 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:12.049 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.370 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.716 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.061 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.407 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.755 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.764 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.112 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:22.237 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
3:23.218 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
3:23.970 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
3:24.907 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
3:25.661 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
3:26.415 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
3:27.169 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
3:27.923 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
3:28.677 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:29.433 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:30.367 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:31.304 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:32.242 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:33.179 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:34.763 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:36.009 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:37.670 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:39.298 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:40.850 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:42.016 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:43.337 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.683 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.029 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.375 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.721 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.476 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.076 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.487 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.499 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:54.845 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:55.856 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:57.203 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:58.214 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
3:59.206 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:00.527 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:01.848 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:01.848 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:02.888 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:04.455 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:05.494 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:06.878 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:07.918 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:08.956 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.995 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.034 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.093 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.503 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.913 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.325 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.861 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.922 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.333 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.745 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.156 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.568 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.978 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.388 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:28.799 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:29.859 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:30.918 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:32.329 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:33.338 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:34.347 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
4:35.357 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.705 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:38.052 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:39.373 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:40.694 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:42.013 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:42.767 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:43.729 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:44.692 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:45.677 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:46.613 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:47.550 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:48.485 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:49.422 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:50.359 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:51.294 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:52.046 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:52.982 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:53.917 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:55.106 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:56.689 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:57.934 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:59.595 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81741 81741 44242
Intellect 59165 56934 46898 (20870)
Spirit 0 0 0
Health 4904460 4904460 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59165 56934 0
Crit 20.32% 20.32% 6128
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.77% 58.77% 7249
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 956, weapon: { 4423 - 8216, 2.6 }, stats: { +1567 Int, +2350 Sta, +443 Crit, +426 Mastery, +19940 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 956, stats: { +2057 Int, +3085 Sta, +582 Crit, +559 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="2ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,ilevel=956
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.88
# gear_stamina=44242
# gear_intellect=46898
# gear_crit_rating=6128
# gear_haste_rating=11779
# gear_mastery_rating=7249
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

3ilevel : 1093787 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1093786.6 1093786.6 874.3 / 0.080% 161803.4 / 14.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
3ilevel 1093787
Earth Shock 105279 9.6% 16.4 17.57sec 1925087 1989500 Direct 16.4 1357670 3760252 1925179 23.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.40 16.40 0.00 0.00 0.9677 0.0000 31579334.01 31579334.01 0.00 1989500.03 1989500.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.53 76.38% 1357669.81 1148435 1586054 1358174.67 1259902 1474612 17011642 17011642 0.00
crit 3.87 23.62% 3760251.84 3178868 4390197 3705958.40 0 4390197 14567692 14567692 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60972 (93269) 5.6% (8.5%) 22.1 13.76sec 1265864 955266 Direct 22.0 588967 1629931 829499 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.04 0.00 0.00 1.3252 0.0000 18278409.05 18278409.05 0.00 955265.76 955265.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.94 76.90% 588966.99 527396 646787 589109.50 557936 626278 9979771 9979771 0.00
crit 5.09 23.10% 1629930.81 1459831 1790305 1624421.05 0 1790305 8298638 8298638 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 32298 3.0% 14.0 21.02sec 692762 0 Direct 13.9 494768 1369619 694436 22.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.97 13.94 0.00 0.00 0.0000 0.0000 9680309.24 9680309.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.76 77.18% 494767.68 443012 543301 494862.12 458673 526612 5323015 5323015 0.00
crit 3.18 22.82% 1369618.90 1226258 1503856 1321097.37 0 1503856 4357295 4357295 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 122369 11.2% 11.2 27.78sec 3263047 3400207 Direct 11.2 87373 245794 205048 74.3%  
Periodic 236.4 48126 183660 145118 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.35 236.35 0.9597 1.2616 36599830.12 36599830.12 0.00 118462.15 3400207.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.88 25.72% 87372.56 78753 96581 86323.83 0 96581 252057 252057 0.00
crit 8.33 74.28% 245793.92 217988 267336 245842.96 230322 259391 2047871 2047871 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.2 28.44% 48126.08 102 53120 48118.28 43471 50419 3234465 3234465 0.00
crit 169.1 71.56% 183659.64 131 205852 183752.32 173880 192007 31065437 31065437 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 119451 10.9% 38.3 7.55sec 934255 977499 Direct 38.3 659792 1827439 934249 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.32 38.32 0.00 0.00 0.9558 0.0000 35804827.69 35804827.69 0.00 977499.46 977499.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.32 76.49% 659791.80 560679 731673 660086.59 631178 695250 19342435 19342435 0.00
crit 9.01 23.51% 1827439.19 1379520 2025270 1826808.82 1651428 2009217 16462392 16462392 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 34171 (52440) 3.1% (4.8%) 9.7 32.16sec 1622589 1274182 Direct 9.7 748654 2074154 1059525 23.5%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2735 0.0000 10243906.05 10243906.05 0.00 1274181.75 1274181.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.40 76.54% 748654.02 671178 823118 748961.05 671178 812243 5540070 5540070 0.00
crit 2.27 23.46% 2074153.62 1857820 2278390 1909191.00 0 2278390 4703836 4703836 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18269 1.7% 6.2 47.29sec 884525 0 Direct 6.2 629201 1742156 886596 23.1%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.20 6.18 0.00 0.00 0.0000 0.0000 5480770.95 5480770.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.75 76.88% 629200.69 563789 691419 628201.90 0 691419 2990723 2990723 0.00
crit 1.43 23.12% 1742156.26 1560569 1913848 1380915.31 0 1913848 2490048 2490048 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 151539 (237767) 13.9% (21.8%) 59.1 5.02sec 1206848 1034623 Direct 58.9 0 771128 771128 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.07 58.92 0.00 0.00 1.1665 0.0000 45434937.49 45434937.49 0.00 1034622.88 1034622.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.92 100.00% 771127.70 700766 859403 771218.59 749549 810694 45434937 45434937 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 78005 7.1% 37.6 7.83sec 621253 0 Direct 37.5 0 623062 623062 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.64 37.53 0.00 0.00 0.0000 0.0000 23383830.05 23383830.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.53 100.00% 623061.59 566169 694337 623120.77 599159 652301 23383830 23383830 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8224 0.8% 44.0 6.13sec 56073 0 Direct 44.0 45212 92216 56072 23.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.99 43.99 0.00 0.00 0.0000 0.0000 2466749.06 2466749.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.83 76.89% 45212.01 43448 48439 45221.93 43561 47703 1529411 1529411 0.00
crit 10.16 23.11% 92215.96 88634 98815 92229.96 0 98815 937338 937338 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 104262 (191004) 9.5% (17.5%) 96.2 3.03sec 594900 495471 Direct 96.2 229782 638268 324720 23.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.24 96.24 0.00 0.00 1.2007 0.0000 31251883.46 31251883.46 0.00 495471.37 495471.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.87 76.76% 229782.13 156087 574266 230038.35 197900 266991 16974492 16974492 0.00
crit 22.37 23.24% 638268.36 432050 1589568 638380.88 459341 973600 14277392 14277392 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 86742 7.9% 93.8 3.79sec 277121 0 Direct 93.8 196006 546119 277115 23.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.83 93.83 0.00 0.00 0.0000 0.0000 26001319.31 26001319.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.09 76.83% 196005.64 131113 482383 196028.87 152379 246450 14129817 14129817 0.00
crit 21.74 23.17% 546118.84 362922 1335237 545906.05 385344 863048 11871502 11871502 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59614) 0.0% (5.4%) 3.0 120.39sec 5944903 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.90 0.00 0.0000 1.0000 0.00 0.00 0.00 306542.71 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19077 1.7% 37.7 6.97sec 150785 0 Direct 37.5 121869 248614 151374 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.66 37.52 0.00 0.00 0.0000 0.0000 5679012.22 5679012.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.78 76.72% 121869.49 121869 121869 121869.49 121869 121869 3507625 3507625 0.00
crit 8.73 23.28% 248613.77 248614 248614 248556.46 0 248614 2171387 2171387 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40537 3.7% 98.9 2.61sec 122079 0 Direct 98.6 98655 201256 122374 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.88 98.64 0.00 0.00 0.0000 0.0000 12070730.37 12070730.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.83 76.88% 98654.92 98655 98655 98654.92 98655 98655 7481207 7481207 0.00
crit 22.80 23.12% 201256.04 201256 201256 201256.04 201256 201256 4589524 4589524 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 138316 / 85695
Fire Blast 138316 7.8% 98.0 2.96sec 260983 140784 Direct 98.0 211794 423635 260988 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.98 97.98 0.00 0.00 1.8538 0.0000 25570902.79 25570902.79 0.00 140784.13 140784.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.23 76.78% 211794.35 201353 224486 211837.83 207270 219984 15932843 15932843 0.00
crit 22.75 23.22% 423634.71 402706 448973 423712.48 410841 441261 9638060 9638060 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 188843 / 26897
Lightning Blast 188843 2.5% 42.1 6.70sec 191402 204845 Direct 42.1 155312 310619 191400 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.07 42.07 0.00 0.00 0.9344 0.0000 8051830.51 8051830.51 0.00 204844.70 204844.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.29 76.76% 155312.11 149150 166286 155344.42 150671 163195 5015308 5015308 0.00
crit 9.78 23.24% 310618.73 298301 332572 310689.32 298301 332572 3036523 3036523 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
3ilevel
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.66sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0228 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 0.00 0.00 0.8213 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.01sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.19 0.00 0.00 0.00 0.5208 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.20% 32.20% 3.1(3.1) 8.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.7sec 68.7sec 8.73% 8.73% 0.0(0.0) 3.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.73%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.5 27.2sec 23.6sec 34.86% 34.86% 1.5(1.5) 10.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.82% 34.82% 1.4(1.4) 10.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.9sec 23.4sec 33.85% 33.85% 1.8(1.8) 9.9

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.9 26.6 4.2sec 3.0sec 59.20% 61.23% 26.6(32.6) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.64%
  • elemental_focus_2:33.56%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.67% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.43%
  • icefury_2:5.94%
  • icefury_3:5.03%
  • icefury_4:3.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 13.0sec 12.2sec 10.41% 39.75% 1.4(1.4) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.41%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 13.0 4.2 23.0sec 17.1sec 29.95% 29.95% 4.2(4.2) 12.7

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.0sec 69.0sec 13.58% 13.58% 0.0(0.0) 3.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.58%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.1sec 0.0sec 39.90% 39.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.6sec 30.2sec 21.89% 24.18% 1.4(2.9) 0.1

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.14%
  • power_of_the_maelstrom_2:6.35%
  • power_of_the_maelstrom_3:9.40%

Trigger Attempt Success

  • trigger_pct:15.06%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.50% 8.91% 0.0(0.0) 0.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.29%
  • stormkeeper_2:3.69%
  • stormkeeper_3:4.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 78.6sec
Lava Surge: During Lava Burst 3.7 58.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6910.0014.8092.5010.00010.135
Fire Elemental0.4930.0011.6650.5480.0003.417
Lava Burst0.9070.0018.5547.4810.00029.850
Elemental Blast0.5390.0014.4518.9642.07519.784
Icefury1.0160.0018.5477.4310.31821.737

Resources

Resource Usage Type Count Total Average RPE APR
3ilevel
earth_shock Maelstrom 133.9 16062.6 120.0 979.2 1966.0
flame_shock Maelstrom 91.5 1634.4 17.9 145.7 22393.6
frost_shock Maelstrom 312.8 6255.9 20.0 163.2 5723.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 482.10 5722.93 (23.46%) 11.87 62.31 1.08%
Lava Burst Overload Maelstrom 307.22 2662.91 (10.92%) 8.67 102.03 3.69%
Lightning Bolt Maelstrom 785.47 6267.31 (25.69%) 7.98 16.46 0.26%
Lightning Bolt Overload Maelstrom 765.77 4541.33 (18.62%) 5.93 53.26 1.16%
Icefury Maelstrom 79.10 1886.33 (7.73%) 23.85 12.01 0.63%
Icefury Overload Maelstrom 50.57 900.14 (3.69%) 17.80 10.16 1.12%
Resonance Totem Maelstrom 2435.87 2412.55 (9.89%) 0.99 23.32 0.96%
Resource RPS-Gain RPS-Loss
Maelstrom 9.96 9.78
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.01 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 3ilevel Fight Length
Count 8676
Mean 300.00
Minimum 239.96
Maximum 360.04
Spread ( max - min ) 120.08
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.5028
5th Percentile 246.07
95th Percentile 353.91
( 95th Percentile - 5th Percentile ) 107.83
Mean Distribution
Standard Deviation 0.3812
95.00% Confidence Intervall ( 299.25 - 300.74 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 539
0.1% Error 53801
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 44
0.01 Scale Factor Error with Delta=300 1076
DPS
Sample Data 3ilevel Damage Per Second
Count 8676
Mean 1093786.55
Minimum 949857.89
Maximum 1282818.12
Spread ( max - min ) 332960.23
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 41548.5438
5th Percentile 1029627.06
95th Percentile 1165068.78
( 95th Percentile - 5th Percentile ) 135441.73
Mean Distribution
Standard Deviation 446.0628
95.00% Confidence Intervall ( 1092912.29 - 1094660.82 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5543
0.1 Scale Factor Error with Delta=300 14736532
0.05 Scale Factor Error with Delta=300 58946127
0.01 Scale Factor Error with Delta=300 1473653173
Priority Target DPS
Sample Data 3ilevel Priority Target Damage Per Second
Count 8676
Mean 1093786.55
Minimum 949857.89
Maximum 1282818.12
Spread ( max - min ) 332960.23
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 41548.5438
5th Percentile 1029627.06
95th Percentile 1165068.78
( 95th Percentile - 5th Percentile ) 135441.73
Mean Distribution
Standard Deviation 446.0628
95.00% Confidence Intervall ( 1092912.29 - 1094660.82 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5543
0.1 Scale Factor Error with Delta=300 14736532
0.05 Scale Factor Error with Delta=300 58946127
0.01 Scale Factor Error with Delta=300 1473653173
DPS(e)
Sample Data 3ilevel Damage Per Second (Effective)
Count 8676
Mean 1093786.55
Minimum 949857.89
Maximum 1282818.12
Spread ( max - min ) 332960.23
Range [ ( max - min ) / 2 * 100% ] 15.22%
Damage
Sample Data 3ilevel Damage
Count 8676
Mean 293955849.06
Minimum 203164492.10
Maximum 376188137.83
Spread ( max - min ) 173023645.73
Range [ ( max - min ) / 2 * 100% ] 29.43%
DTPS
Sample Data 3ilevel Damage Taken Per Second
Count 8676
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 3ilevel Healing Per Second
Count 8676
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 3ilevel Healing Per Second (Effective)
Count 8676
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 3ilevel Heal
Count 8676
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 3ilevel Healing Taken Per Second
Count 8676
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 3ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 3ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 3ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.01 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.18 totem_mastery,if=buff.resonance_totem.remains<2
9 3.43 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.03 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.55 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.54 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.52 elemental_blast
Keep your EB always on Cooldown.
I 12.42 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.48 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.88 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.66 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.11 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.36 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.84 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.23 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.05 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 19.01 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 74.36 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMLLLMGMGNNRRRHFMSISSSSMMSSHPSSMKNNNNSSSSMHMMMIFRRRSMHMSPSJMLLLMSIKNFHMSNSNMNSOSHSSMSSMSSISMHMK97GMMGNNSHMMIQRRROSMSAJSHPSSSMMKGNNNHMSSSSPSMSOSSHSMSSISMMKHNMNMNNORMRRHIMMJLSSSMIMHSKNMNNSNSMHMSFSSSMISS9SSHSMSSIKMNNH8SNMNFRARRJMHSSPSSMSOSKHMMNNNMNSMSSHISMSSSOSMHSSIKMNNNSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.942 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.959 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.975 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.738 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, lava_surge, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.502 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.266 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:08.045 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:08.824 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:09.859 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:10.637 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:11.414 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.193 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.230 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.265 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.351 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.436 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.254 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.340 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.426 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.244 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.329 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.415 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.501 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.588 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.405 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.492 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.577 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.664 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.751 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.567 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.654 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.741 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.827 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:34.710 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:35.464 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:36.216 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:36.969 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:37.723 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:38.478 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:39.236 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:39.992 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:40.748 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:41.503 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:42.729 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:43.485 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:44.465 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:45.447 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:46.201 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:47.447 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:49.107 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:50.735 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:52.363 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:53.991 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.376 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.788 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.848 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:58.786 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
0:59.540 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:00.476 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:01.230 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:01.985 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:02.741 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:03.497 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:04.252 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:05.187 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:06.124 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:06.880 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:07.817 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact
1:08.570 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact
1:09.323 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact
1:10.306 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due
1:11.968 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due
1:13.550 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due
1:14.738 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due
1:16.322 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due
1:17.512 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:18.858 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
1:19.613 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:20.550 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:21.303 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:22.285 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:23.283 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:24.263 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:25.244 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:26.227 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:27.208 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:28.190 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:28.946 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:29.928 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:30.910 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:32.157 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:33.818 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:35.065 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:36.939 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:38.600 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:40.011 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:41.049 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:41.049 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
1:42.087 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
1:43.470 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
1:44.509 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
1:45.546 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
1:46.584 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:47.643 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.055 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.467 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.474 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.820 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.829 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:54.585 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:55.524 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:56.460 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:57.396 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:58.151 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:59.086 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:00.023 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:00.958 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:00.958 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:01.931 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:02.686 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:03.666 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:04.420 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:05.176 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:05.929 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:07.591 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:08.838 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:10.500 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:12.162 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:13.409 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:14.654 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:15.409 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:16.164 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:17.127 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:18.089 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:19.050 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:20.014 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:20.977 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:21.959 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:22.713 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:23.695 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:24.678 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:25.660 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:26.416 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:27.398 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:29.056 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:30.780 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:32.441 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:34.100 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:35.759 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:37.169 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:38.228 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:39.639 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:40.696 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:42.108 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.569 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:44.982 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:46.041 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:47.052 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
2:48.044 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:49.364 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:50.356 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:51.347 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.339 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.685 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.696 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.043 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:57.427 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:58.811 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.849 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.889 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:02.273 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.333 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.392 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.451 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.509 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.920 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.980 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.039 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.452 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.836 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.220 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.603 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:16.640 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:18.023 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:19.081 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:20.141 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:21.552 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:22.592 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:23.975 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:25.016 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.400 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:27.783 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:28.703 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:29.456 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:30.393 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:31.330 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:32.267 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:33.203 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:33.960 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:34.898 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:35.834 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:36.767 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:37.704 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:38.685 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:39.667 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:40.604 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:42.187 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:43.771 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:45.353 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:46.542 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:48.125 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:49.446 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:50.438 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:51.477 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:53.045 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:53.798 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:55.119 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:56.108 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:57.429 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
3:58.439 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.449 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.798 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.798 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.146 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.491 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.552 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.964 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.375 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.434 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.494 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.553 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.614 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.026 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.437 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.849 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.909 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.320 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.707 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:21.091 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:22.130 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:23.451 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:24.442 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:25.453 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:26.463 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
4:27.475 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
4:28.485 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.831 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:31.150 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:32.469 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.851 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:35.238 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.297 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.708 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.120 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.532 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.943 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.354 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.412 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.823 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.234 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.644 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.055 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.467 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.526 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.938 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:55.348 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:56.406 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:57.466 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:58.504 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:59.888 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81824 81824 44295
Intellect 59405 57174 47126 (20870)
Spirit 0 0 0
Health 4909440 4909440 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59405 57174 0
Crit 20.33% 20.33% 6133
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.79% 58.79% 7253
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 957, weapon: { 4465 - 8293, 2.6 }, stats: { +1582 Int, +2373 Sta, +445 Crit, +428 Mastery, +20134 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 957, stats: { +2076 Int, +3115 Sta, +585 Crit, +561 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="3ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,ilevel=957
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=934.00
# gear_stamina=44295
# gear_intellect=47126
# gear_crit_rating=6133
# gear_haste_rating=11779
# gear_mastery_rating=7253
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

baseline : 1081489 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1081488.5 1081488.5 864.5 / 0.080% 157515.4 / 14.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 1081489
Earth Shock 103739 9.6% 16.4 17.61sec 1898027 1960778 Direct 16.4 1342922 3716995 1897931 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.39 16.39 0.00 0.00 0.9680 0.0000 31113618.07 31113618.07 0.00 1960777.54 1960777.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.56 76.62% 1342921.87 1135077 1569506 1343388.52 1245766 1442544 16866804 16866804 0.00
crit 3.83 23.38% 3716994.92 3141892 4344393 3656983.01 0 4344393 14246815 14246815 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60238 (92288) 5.6% (8.5%) 22.1 13.76sec 1252912 945248 Direct 22.0 582235 1611528 819720 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.04 0.00 0.00 1.3255 0.0000 18064754.00 18064754.00 0.00 945247.94 945247.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.95 76.93% 582235.11 521261 640038 582384.90 557375 610459 9870278 9870278 0.00
crit 5.08 23.07% 1611527.60 1442850 1771626 1606679.42 0 1771626 8194476 8194476 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 32050 3.0% 14.0 21.04sec 686031 0 Direct 14.0 489127 1353396 687807 23.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 13.97 0.00 0.00 0.0000 0.0000 9611160.37 9611160.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.76 77.02% 489126.74 437859 537632 489271.11 455812 529019 5264503 5264503 0.00
crit 3.21 22.98% 1353396.23 1211994 1488166 1305212.65 0 1488166 4346657 4346657 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120940 11.2% 11.2 27.78sec 3224142 3357772 Direct 11.2 86444 243088 202755 74.3%  
Periodic 236.3 47591 181655 143464 71.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.28 236.28 0.9602 1.2620 36173278.60 36173278.60 0.00 117077.37 3357772.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.89 25.74% 86443.74 77837 95573 85651.96 0 95573 249690 249690 0.00
crit 8.33 74.26% 243087.63 215453 264547 243133.98 227613 256204 2025174 2025174 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.3 28.49% 47591.06 140 52566 47584.85 43761 49764 3203267 3203267 0.00
crit 169.0 71.51% 181655.30 129 203705 181746.57 169623 189983 30695148 30695148 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 118235 10.9% 38.3 7.54sec 924859 967947 Direct 38.3 652351 1807231 924884 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.32 38.32 0.00 0.00 0.9555 0.0000 35443304.43 35443304.43 0.00 967946.70 967946.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.28 76.40% 652351.38 486481 724039 652648.20 621496 685927 19101000 19101000 0.00
crit 9.04 23.60% 1807231.46 1632219 2004141 1806605.91 1632219 1961330 16342305 16342305 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 33698 (51767) 3.1% (4.8%) 9.7 32.16sec 1601216 1258072 Direct 9.7 740305 2051713 1044754 23.2%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2728 0.0000 10101961.89 10101961.89 0.00 1258072.04 1258072.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.42 76.78% 740304.88 663371 814530 740486.76 678200 814530 5496215 5496215 0.00
crit 2.24 23.22% 2051712.55 1836210 2254619 1885576.67 0 2254619 4605747 4605747 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18069 1.7% 6.2 47.49sec 878219 0 Direct 6.2 622231 1723858 880470 23.4%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.17 6.15 0.00 0.00 0.0000 0.0000 5416356.69 5416356.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.71 76.56% 622230.77 557231 684205 621531.63 0 684205 2930423 2930423 0.00
crit 1.44 23.44% 1723857.64 1542417 1893880 1359036.26 0 1893880 2485933 2485933 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 149907 (235032) 13.9% (21.8%) 59.1 5.02sec 1192512 1022197 Direct 59.0 0 762407 762407 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.10 58.96 0.00 0.00 1.1666 0.0000 44951489.68 44951489.68 0.00 1022197.49 1022197.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.96 100.00% 762407.21 692614 850437 762527.85 740565 788409 44951490 44951490 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 76995 7.1% 37.6 7.90sec 614075 0 Direct 37.5 0 615940 615940 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.60 37.49 0.00 0.00 0.0000 0.0000 23092022.83 23092022.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.49 100.00% 615939.64 559584 687093 616053.94 593488 641557 23092023 23092023 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8130 0.8% 43.9 6.14sec 55509 0 Direct 43.9 44708 91222 55508 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.94 43.94 0.00 0.00 0.0000 0.0000 2439048.59 2439048.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.74 76.78% 44708.35 42943 47934 44720.28 42943 47012 1508345 1508345 0.00
crit 10.20 23.22% 91222.24 87603 97785 91211.42 0 97785 930703 930703 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 102964 (188645) 9.5% (17.5%) 96.2 3.04sec 587857 489424 Direct 96.2 227190 631529 320847 23.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.17 96.17 0.00 0.00 1.2011 0.0000 30856984.28 30856984.28 0.00 489424.39 489424.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.90 76.84% 227190.09 154272 568274 227448.65 194147 258070 16789130 16789130 0.00
crit 22.28 23.16% 631528.87 427024 1572984 631816.18 455396 995786 14067854 14067854 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 85681 7.9% 93.6 3.80sec 274260 0 Direct 93.6 193911 540171 274263 23.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.63 93.63 0.00 0.00 0.0000 0.0000 25678874.19 25678874.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.90 76.80% 193911.28 129588 477350 194012.50 148424 241298 13943520 13943520 0.00
crit 21.73 23.20% 540171.12 358700 1321306 540567.58 382809 921485 11735354 11735354 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59630) 0.0% (5.5%) 3.0 120.40sec 5947105 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.92 0.00 0.0000 1.0000 0.00 0.00 0.00 306603.10 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19097 1.8% 37.7 6.94sec 150764 0 Direct 37.6 121869 248614 151324 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.72 37.58 0.00 0.00 0.0000 0.0000 5686824.01 5686824.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.84 76.76% 121869.49 121869 121869 121869.49 121869 121869 3515321 3515321 0.00
crit 8.73 23.24% 248613.77 248614 248614 248555.06 0 248614 2171503 2171503 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40533 3.7% 98.9 2.62sec 122083 0 Direct 98.6 98655 201256 122377 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.88 98.64 0.00 0.00 0.0000 0.0000 12071627.81 12071627.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.84 76.88% 98654.92 98655 98655 98654.92 98655 98655 7481640 7481640 0.00
crit 22.81 23.12% 201256.04 201256 201256 201256.04 201256 201256 4589988 4589988 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 136614 / 84664
Fire Blast 136614 7.8% 97.9 2.95sec 257962 139043 Direct 97.9 209433 418902 257957 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.93 97.93 0.00 0.00 1.8553 0.0000 25262133.50 25262133.50 0.00 139042.82 139042.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.24 76.83% 209433.18 199011 222144 209477.67 204858 216625 15758026 15758026 0.00
crit 22.69 23.17% 418901.56 398022 444288 418989.37 403497 438482 9504107 9504107 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186490 / 26548
Lightning Blast 186490 2.5% 42.0 6.70sec 189201 202296 Direct 42.0 153580 307192 189209 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.00 42.00 0.00 0.00 0.9353 0.0000 7946591.80 7946591.80 0.00 202296.01 202296.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.26 76.81% 153579.71 147415 164551 153612.86 149173 161055 4954563 4954563 0.00
crit 9.74 23.19% 307192.38 294831 329102 307283.99 294831 329102 2992028 2992028 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
baseline
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.57sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0232 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.59sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8211 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.96sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.19 0.00 0.00 0.00 0.5206 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.17% 32.17% 3.1(3.1) 7.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.0sec 69.0sec 8.68% 8.68% 0.0(0.0) 3.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.68%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.7sec 34.82% 34.82% 1.4(1.4) 10.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.6sec 34.90% 34.90% 1.4(1.4) 10.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.9sec 23.4sec 33.92% 33.92% 1.8(1.8) 9.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.8 26.5 4.2sec 3.0sec 59.18% 61.20% 26.5(32.6) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.64%
  • elemental_focus_2:33.54%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.64% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.41%
  • icefury_2:5.93%
  • icefury_3:5.04%
  • icefury_4:3.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 13.0sec 12.2sec 10.40% 39.77% 1.4(1.4) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.40%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.0 4.2 22.9sec 17.1sec 30.00% 30.00% 4.2(4.2) 12.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.4sec 69.4sec 13.49% 13.49% 0.0(0.0) 3.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.49%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.0sec 0.0sec 39.89% 39.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.8sec 30.3sec 21.88% 24.10% 1.4(3.0) 0.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.20%
  • power_of_the_maelstrom_2:6.34%
  • power_of_the_maelstrom_3:9.35%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.44% 8.92% 0.0(0.0) 0.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.25%
  • stormkeeper_2:3.67%
  • stormkeeper_3:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 78.7sec
Lava Surge: During Lava Burst 3.7 57.8sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6880.0014.6422.4730.0008.767
Fire Elemental0.4940.0011.6410.5430.0003.459
Lava Burst0.9050.0018.0047.4340.00028.719
Elemental Blast0.5400.0015.2868.9832.55418.409
Icefury1.0230.0019.1507.4960.55220.498

Resources

Resource Usage Type Count Total Average RPE APR
baseline
earth_shock Maelstrom 131.8 15818.9 120.0 965.0 1966.9
flame_shock Maelstrom 90.2 1609.8 17.8 143.5 22470.3
frost_shock Maelstrom 308.2 6164.6 20.0 160.9 5749.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 475.35 5643.23 (23.49%) 11.87 61.03 1.07%
Lava Burst Overload Maelstrom 302.43 2624.21 (10.92%) 8.68 97.65 3.59%
Lightning Bolt Maelstrom 773.50 6171.94 (25.69%) 7.98 16.08 0.26%
Lightning Bolt Overload Maelstrom 753.06 4464.89 (18.59%) 5.93 53.45 1.18%
Icefury Maelstrom 77.95 1859.25 (7.74%) 23.85 11.52 0.62%
Icefury Overload Maelstrom 49.59 882.68 (3.67%) 17.80 10.01 1.12%
Resonance Totem Maelstrom 2400.50 2377.56 (9.90%) 0.99 22.95 0.96%
Resource RPS-Gain RPS-Loss
Maelstrom 9.96 9.78
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.13 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Shaman_Elemental_T20M Fight Length
Count 8469
Mean 300.00
Minimum 240.01
Maximum 360.01
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.3717
5th Percentile 246.21
95th Percentile 353.75
( 95th Percentile - 5th Percentile ) 107.54
Mean Distribution
Standard Deviation 0.3844
95.00% Confidence Intervall ( 299.25 - 300.76 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 535
0.1% Error 53402
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1069
DPS
Sample Data Shaman_Elemental_T20M Damage Per Second
Count 8469
Mean 1081488.52
Minimum 945053.53
Maximum 1240133.63
Spread ( max - min ) 295080.10
Range [ ( max - min ) / 2 * 100% ] 13.64%
Standard Deviation 40593.0289
5th Percentile 1017575.55
95th Percentile 1150434.33
( 95th Percentile - 5th Percentile ) 132858.78
Mean Distribution
Standard Deviation 441.0983
95.00% Confidence Intervall ( 1080623.98 - 1082353.06 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5412
0.1 Scale Factor Error with Delta=300 14066518
0.05 Scale Factor Error with Delta=300 56266070
0.01 Scale Factor Error with Delta=300 1406651727
Priority Target DPS
Sample Data Shaman_Elemental_T20M Priority Target Damage Per Second
Count 8469
Mean 1081488.52
Minimum 945053.53
Maximum 1240133.63
Spread ( max - min ) 295080.10
Range [ ( max - min ) / 2 * 100% ] 13.64%
Standard Deviation 40593.0289
5th Percentile 1017575.55
95th Percentile 1150434.33
( 95th Percentile - 5th Percentile ) 132858.78
Mean Distribution
Standard Deviation 441.0983
95.00% Confidence Intervall ( 1080623.98 - 1082353.06 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5412
0.1 Scale Factor Error with Delta=300 14066518
0.05 Scale Factor Error with Delta=300 56266070
0.01 Scale Factor Error with Delta=300 1406651727
DPS(e)
Sample Data Shaman_Elemental_T20M Damage Per Second (Effective)
Count 8469
Mean 1081488.52
Minimum 945053.53
Maximum 1240133.63
Spread ( max - min ) 295080.10
Range [ ( max - min ) / 2 * 100% ] 13.64%
Damage
Sample Data Shaman_Elemental_T20M Damage
Count 8469
Mean 290701305.45
Minimum 205799526.46
Maximum 379340938.85
Spread ( max - min ) 173541412.39
Range [ ( max - min ) / 2 * 100% ] 29.85%
DTPS
Sample Data Shaman_Elemental_T20M Damage Taken Per Second
Count 8469
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaman_Elemental_T20M Healing Per Second
Count 8469
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shaman_Elemental_T20M Healing Per Second (Effective)
Count 8469
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaman_Elemental_T20M Heal
Count 8469
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaman_Elemental_T20M Healing Taken Per Second
Count 8469
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaman_Elemental_T20M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Shaman_Elemental_T20MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Shaman_Elemental_T20M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.99 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.17 totem_mastery,if=buff.resonance_totem.remains<2
9 3.35 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.96 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.43 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.33 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.98 elemental_blast
Keep your EB always on Cooldown.
I 12.14 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.37 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.64 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.58 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 58.72 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.64 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.69 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.10 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.00 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.43 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 72.62 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMLLGLGNNOSMHSSSISSMMRMPRRSSHMMSSSPKNSMNNHSSNSFMSSSSSMHPSSSSJMOSKHMGNNNSSMMSISSSHMRRRISMMOHSKNMNNMNS97HMQSIMMRRRASHIJMMOSKNNNSNMSHMSSSSIMSSHMSOSSSIMKMHMNNMNNSSSSHMMPSSMSJOSSHKMGMGNNMSSPHSMMSSSSIMHM9FMKMNNN8NSHMRRRPMASOSHSJMSSSIKMNNHNSMMNSSSSMHOSSIMSSSSKHGMGMNNRRRISM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.878 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.963 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.049 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:05.136 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:06.222 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:07.039 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:07.856 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:08.673 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:09.489 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:10.307 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:11.104 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:11.903 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:12.703 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:13.768 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.833 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.025 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.089 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.106 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.121 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:19.875 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:20.629 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:21.383 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.138 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.892 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:23.647 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:24.403 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:25.159 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:25.914 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:26.669 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:27.427 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:28.182 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:28.940 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:29.695 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:30.449 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:31.203 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:32.421 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:33.638 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:34.555 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:35.774 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due, potion_of_prolonged_power
0:36.688 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, mark_of_the_claw, potion_of_prolonged_power
0:37.885 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, mark_of_the_claw, potion_of_prolonged_power
0:39.080 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, mark_of_the_claw, potion_of_prolonged_power
0:39.977 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
0:40.775 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:41.999 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:43.384 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:44.705 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:45.695 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.015 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:47.769 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:48.687 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:49.624 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:50.560 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:51.493 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:52.429 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:53.409 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:54.393 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:55.374 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:56.128 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:57.109 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:58.072 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
0:59.698 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:01.327 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:02.549 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:04.178 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:05.400 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:06.622 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:08.007 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
1:09.390 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact
1:10.373 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact
1:11.128 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact
1:11.882 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact
1:12.635 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact
1:13.390 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:14.145 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:14.898 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:15.653 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:16.637 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:17.617 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:18.371 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:19.355 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:20.337 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:21.321 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:23.046 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:24.707 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:26.367 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:28.029 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:29.690 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.750 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.161 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.221 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.631 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.691 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.100 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:38.484 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:39.866 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:40.907 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:42.291 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:43.329 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:44.387 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:45.448 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:46.508 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.918 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.975 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.975 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.510 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.921 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.675 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.085 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.143 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.202 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.614 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.025 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:00.435 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.847 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.847 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.259 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.671 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.730 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.788 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.847 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:08.830 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:09.584 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:10.340 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:11.324 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
2:12.078 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
2:12.832 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
2:13.585 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
2:14.340 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
2:15.095 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:16.080 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:16.836 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:17.797 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:18.553 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:19.516 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
2:21.141 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
2:22.767 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:24.428 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:25.674 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:27.335 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.746 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.157 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.568 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:32.888 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:34.209 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:35.201 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:36.523 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:37.844 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:39.163 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:40.155 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:41.148 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:42.637 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:44.049 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:45.461 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:46.520 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:47.531 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:48.541 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
2:49.888 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:50.898 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:51.907 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:53.227 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:54.548 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:55.869 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:57.253 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.866 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.214 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.225 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.236 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.582 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:04.902 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:06.224 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:07.544 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:08.536 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:09.527 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.586 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.646 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.057 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.403 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:15.751 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:16.762 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:17.772 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:18.782 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:19.792 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:20.802 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.150 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.161 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.573 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.633 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.044 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.427 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.465 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.848 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.233 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.616 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.029 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.442 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.501 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.914 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.452 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.511 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.523 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.534 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.544 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:45.864 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:47.184 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:48.176 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:49.168 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:50.159 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:50.916 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:51.977 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.388 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.801 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.212 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.623 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.035 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.419 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.458 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.842 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.842 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:04.225 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:05.264 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.676 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.206 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.618 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.628 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.975 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.967 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.958 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:14.951 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:15.944 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:17.264 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:18.584 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:19.596 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:20.657 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:22.068 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:23.129 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:24.475 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:25.485 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:26.831 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:27.842 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.189 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.534 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.880 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.229 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.640 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.051 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.110 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.522 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.934 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.993 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.405 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.817 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:45.201 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:46.162 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:47.125 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:48.224 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw
4:49.187 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw
4:49.941 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, mark_of_the_claw
4:50.695 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, mark_of_the_claw
4:51.448 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, mark_of_the_claw
4:52.367 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:53.122 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
4:53.877 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:54.813 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:55.751 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:56.687 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:57.877 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:59.460 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81584 81584 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4895040 4895040 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="baseline"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

ctt_nature : 1084715 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1084715.4 1084715.4 867.2 / 0.080% 161388.4 / 14.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ctt_nature 1084715
Earth Shock 104577 9.7% 16.4 17.64sec 1914632 1978031 Direct 16.4 1355690 3752534 1914715 23.3%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.38 16.38 0.00 0.00 0.9680 0.0000 31363666.60 31363666.60 0.00 1978031.45 1978031.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.56 76.68% 1355690.20 1145991 1584597 1356161.36 1252788 1476927 17028504 17028504 0.00
crit 3.82 23.32% 3752533.53 3172102 4386166 3693453.24 0 4386166 14335162 14335162 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60776 (92897) 5.6% (8.6%) 22.1 13.76sec 1261696 951880 Direct 22.0 587882 1628114 827300 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.03 0.00 0.00 1.3255 0.0000 18224454.07 18224454.07 0.00 951880.45 951880.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.96 76.99% 587882.07 526273 646193 588049.32 555895 618154 9970640 9970640 0.00
crit 5.07 23.01% 1628114.12 1456724 1788661 1621948.60 0 1788661 8253814 8253814 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 32120 3.0% 13.9 21.14sec 690767 0 Direct 13.9 493864 1367490 692386 22.7%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.91 0.00 0.00 0.0000 0.0000 9632327.30 9632327.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.75 77.28% 493864.05 442069 542802 494015.48 456893 528670 5309729 5309729 0.00
crit 3.16 22.72% 1367489.65 1223648 1502476 1318698.01 0 1502476 4322598 4322598 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 121005 11.1% 11.2 27.79sec 3228004 3363734 Direct 11.2 86382 243078 202597 74.2%  
Periodic 236.3 47575 181654 143548 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 236.27 236.27 0.9597 1.2621 36187049.36 36187049.36 0.00 117127.63 3363733.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.90 25.83% 86382.26 77837 95573 85585.20 0 95573 250168 250168 0.00
crit 8.31 74.17% 243077.93 215453 264547 243126.86 228489 256204 2021028 2021028 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.1 28.42% 47574.73 116 52566 47566.59 43749 49929 3194412 3194412 0.00
crit 169.1 71.58% 181653.96 136 203705 181752.11 170697 191463 30721442 30721442 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 118082 10.9% 38.3 7.55sec 923287 966347 Direct 38.3 652373 1807079 923307 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.32 38.32 0.00 0.00 0.9555 0.0000 35384726.31 35384726.31 0.00 966346.95 966346.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.33 76.54% 652373.10 508231 724039 652663.70 619635 689420 19136052 19136052 0.00
crit 8.99 23.46% 1807078.81 1632219 2004141 1806422.04 1632219 2004141 16248675 16248675 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 33678 (51773) 3.1% (4.8%) 9.7 32.16sec 1601303 1257472 Direct 9.7 740128 2051010 1044223 23.2%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2735 0.0000 10092739.94 10092739.94 0.00 1257471.91 1257471.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.42 76.80% 740128.29 663371 814530 740347.41 663371 803655 5494052 5494052 0.00
crit 2.24 23.20% 2051010.26 1836210 2254619 1887852.21 0 2254619 4598688 4598688 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18095 1.7% 6.2 47.27sec 877657 0 Direct 6.2 621843 1723272 880258 23.5%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.18 6.17 0.00 0.00 0.0000 0.0000 5426978.40 5426978.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.72 76.55% 621842.81 557231 684205 620434.77 0 684205 2935067 2935067 0.00
crit 1.45 23.45% 1723272.25 1542417 1893880 1356704.60 0 1893880 2491912 2491912 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 149737 (234815) 13.8% (21.7%) 59.0 5.04sec 1192676 1022013 Direct 58.9 0 762411 762411 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.04 58.89 0.00 0.00 1.1670 0.0000 44898393.64 44898393.64 0.00 1022013.39 1022013.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.89 100.00% 762411.38 692614 850437 762512.12 741850 784755 44898394 44898394 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 76964 7.1% 37.6 7.83sec 614081 0 Direct 37.5 0 615943 615943 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.59 37.47 0.00 0.00 0.0000 0.0000 23081408.19 23081408.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.47 100.00% 615942.81 559584 687093 616018.91 591412 641444 23081408 23081408 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8115 0.7% 43.9 6.17sec 55478 0 Direct 43.9 44714 91208 55478 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.87 43.87 0.00 0.00 0.0000 0.0000 2433854.61 2433854.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.71 76.85% 44713.65 42943 47934 44725.17 43103 46817 1507494 1507494 0.00
crit 10.16 23.15% 91207.94 87603 97785 91209.68 0 97785 926361 926361 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 104126 (190742) 9.6% (17.6%) 96.2 3.03sec 594323 494717 Direct 96.2 229472 637946 324398 23.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.20 96.20 0.00 0.00 1.2013 0.0000 31207264.15 31207264.15 0.00 494716.94 494716.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.84 76.76% 229471.58 155755 573739 229729.59 197601 265344 16944446 16944446 0.00
crit 22.36 23.24% 637945.60 431130 1588108 638166.91 450582 961073 14262818 14262818 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 86616 8.0% 93.7 3.81sec 277178 0 Direct 93.7 195919 545805 277158 23.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.68 93.68 0.00 0.00 0.0000 0.0000 25964698.74 25964698.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.92 76.78% 195919.35 130834 481940 195988.97 152180 252104 14091679 14091679 0.00
crit 21.75 23.22% 545804.56 362149 1334011 545938.10 390862 839935 11873020 11873020 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59518) 0.0% (5.5%) 3.0 120.40sec 5937021 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.77 0.00 0.0000 1.0000 0.00 0.00 0.00 306704.93 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19068 1.7% 37.6 6.96sec 150853 0 Direct 37.5 121869 248614 151447 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.62 37.48 0.00 0.00 0.0000 0.0000 5675671.07 5675671.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.73 76.66% 121869.49 121869 121869 121869.49 121869 121869 3501117 3501117 0.00
crit 8.75 23.34% 248613.77 248614 248614 248584.60 0 248614 2174554 2174554 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40451 3.7% 98.6 2.62sec 122132 0 Direct 98.3 98655 201256 122441 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.60 98.35 0.00 0.00 0.0000 0.0000 12042059.60 12042059.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.55 76.82% 98654.92 98655 98655 98654.92 98655 98655 7453261 7453261 0.00
crit 22.80 23.18% 201256.04 201256 201256 201256.04 201256 201256 4588798 4588798 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 136568 / 84723
Fire Blast 136568 7.8% 98.0 2.96sec 257833 138991 Direct 98.0 209447 418854 257837 23.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.03 98.03 0.00 0.00 1.8550 0.0000 25275555.59 25275555.59 0.00 138991.23 138991.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.38 76.89% 209446.97 199011 222144 209492.18 204435 215713 15787943 15787943 0.00
crit 22.65 23.11% 418853.57 398022 444288 418942.64 405514 435496 9487613 9487613 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186503 / 26583
Lightning Blast 186503 2.4% 42.1 6.73sec 189147 202293 Direct 42.1 153574 307163 189147 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.06 42.06 0.00 0.00 0.9350 0.0000 7954766.15 7954766.15 0.00 202292.96 202292.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.31 76.84% 153573.55 147415 164551 153607.62 148966 161183 4962671 4962671 0.00
crit 9.74 23.16% 307162.61 294831 329102 307203.25 0 329102 2992095 2992095 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ctt_nature
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.66sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.39 0.00 0.00 0.00 1.0233 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 0.00 0.00 0.8211 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.13sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5212 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.14% 32.14% 3.1(3.1) 8.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.5sec 69.5sec 8.64% 8.64% 0.0(0.0) 3.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.64%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.7sec 34.90% 34.90% 1.4(1.4) 10.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.90% 34.90% 1.4(1.4) 10.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.0sec 23.5sec 33.77% 33.77% 1.8(1.8) 9.9

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.8 26.5 4.2sec 3.0sec 59.19% 61.18% 26.5(32.5) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.64%
  • elemental_focus_2:33.55%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.66% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.42%
  • icefury_2:5.98%
  • icefury_3:5.02%
  • icefury_4:3.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.4 13.0sec 12.2sec 10.36% 39.69% 1.4(1.4) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.36%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.93% 29.93% 4.2(4.2) 12.6

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.8sec 69.8sec 13.44% 13.44% 0.0(0.0) 3.3

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.44%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 97.9sec 0.0sec 39.93% 39.93% 0.0(0.0) 2.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.9sec 30.5sec 21.79% 24.08% 1.4(2.9) 0.1

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.12%
  • power_of_the_maelstrom_2:6.31%
  • power_of_the_maelstrom_3:9.36%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.47% 8.93% 0.0(0.0) 0.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.27%
  • stormkeeper_2:3.67%
  • stormkeeper_3:4.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 78.7sec
Lava Surge: During Lava Burst 3.7 57.7sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6850.0014.6192.4680.0008.902
Fire Elemental0.4950.0011.7940.5410.0003.288
Lava Burst0.9120.0018.9327.4440.00027.331
Elemental Blast0.5400.0014.6688.9872.36218.962
Icefury1.0210.0017.9567.4590.44024.156

Resources

Resource Usage Type Count Total Average RPE APR
ctt_nature
earth_shock Maelstrom 132.9 15940.9 120.0 973.1 1967.5
flame_shock Maelstrom 90.9 1623.5 17.9 144.8 22289.7
frost_shock Maelstrom 310.8 6216.6 20.0 162.2 5692.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 478.82 5683.66 (23.46%) 11.87 62.15 1.08%
Lava Burst Overload Maelstrom 304.83 2643.29 (10.91%) 8.67 100.20 3.65%
Lightning Bolt Maelstrom 780.19 6225.17 (25.70%) 7.98 16.32 0.26%
Lightning Bolt Overload Maelstrom 759.71 4504.59 (18.60%) 5.93 53.70 1.18%
Icefury Maelstrom 78.61 1875.21 (7.74%) 23.86 11.34 0.60%
Icefury Overload Maelstrom 50.15 892.82 (3.69%) 17.80 9.90 1.10%
Resonance Totem Maelstrom 2420.58 2397.67 (9.90%) 0.99 22.90 0.95%
Resource RPS-Gain RPS-Loss
Maelstrom 9.96 9.77
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.77 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ctt_nature Fight Length
Count 8524
Mean 300.00
Minimum 239.98
Maximum 360.01
Spread ( max - min ) 120.03
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.3601
5th Percentile 245.40
95th Percentile 354.55
( 95th Percentile - 5th Percentile ) 109.15
Mean Distribution
Standard Deviation 0.3938
95.00% Confidence Intervall ( 299.23 - 300.77 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 565
0.1% Error 56430
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 46
0.01 Scale Factor Error with Delta=300 1129
DPS
Sample Data ctt_nature Damage Per Second
Count 8524
Mean 1084715.41
Minimum 955325.32
Maximum 1277684.52
Spread ( max - min ) 322359.20
Range [ ( max - min ) / 2 * 100% ] 14.86%
Standard Deviation 40849.9702
5th Percentile 1021136.26
95th Percentile 1154768.02
( 95th Percentile - 5th Percentile ) 133631.76
Mean Distribution
Standard Deviation 442.4559
95.00% Confidence Intervall ( 1083848.21 - 1085582.61 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5449
0.1 Scale Factor Error with Delta=300 14245155
0.05 Scale Factor Error with Delta=300 56980618
0.01 Scale Factor Error with Delta=300 1424515429
Priority Target DPS
Sample Data ctt_nature Priority Target Damage Per Second
Count 8524
Mean 1084715.41
Minimum 955325.32
Maximum 1277684.52
Spread ( max - min ) 322359.20
Range [ ( max - min ) / 2 * 100% ] 14.86%
Standard Deviation 40849.9702
5th Percentile 1021136.26
95th Percentile 1154768.02
( 95th Percentile - 5th Percentile ) 133631.76
Mean Distribution
Standard Deviation 442.4559
95.00% Confidence Intervall ( 1083848.21 - 1085582.61 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5449
0.1 Scale Factor Error with Delta=300 14245155
0.05 Scale Factor Error with Delta=300 56980618
0.01 Scale Factor Error with Delta=300 1424515429
DPS(e)
Sample Data ctt_nature Damage Per Second (Effective)
Count 8524
Mean 1084715.41
Minimum 955325.32
Maximum 1277684.52
Spread ( max - min ) 322359.20
Range [ ( max - min ) / 2 * 100% ] 14.86%
Damage
Sample Data ctt_nature Damage
Count 8524
Mean 291615291.98
Minimum 211645820.69
Maximum 374948102.21
Spread ( max - min ) 163302281.53
Range [ ( max - min ) / 2 * 100% ] 28.00%
DTPS
Sample Data ctt_nature Damage Taken Per Second
Count 8524
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ctt_nature Healing Per Second
Count 8524
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ctt_nature Healing Per Second (Effective)
Count 8524
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ctt_nature Heal
Count 8524
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ctt_nature Healing Taken Per Second
Count 8524
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ctt_nature Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ctt_natureTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ctt_nature Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.18 totem_mastery,if=buff.resonance_totem.remains<2
9 3.38 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.98 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.45 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.33 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.12 elemental_blast
Keep your EB always on Cooldown.
I 12.22 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.40 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.71 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.61 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 59.03 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.89 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.73 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.11 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.02 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.55 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 73.12 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMLLGLGNNSSMHFMSSISMRRRSSSISHSMSMSSKGMGMNNHMOSMMIRMRRHMSIJSSMMKNNHMMNNOSSSMSHIMMSSSSMPS97HKNMNNSFSNSMQSHSSSSMIAJSSSHMSOKNMNNNSHSMSSPSSMSSHSSMISSKNFMHNMNNMMSSSPHJMLLLSSMISHFKMMNNNRNRMHMRS9SIMOQRHMMRRKGGNMNSMSHISSMASSJSSMHIMMOSMSMSKNMGNHNSSMIMSSSHMSOSSMISSHKMNNNN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.963 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.050 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:05.138 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:06.223 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:07.039 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:07.854 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:08.670 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:09.486 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:10.302 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:11.120 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.936 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.024 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.110 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.196 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.283 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.099 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.916 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.002 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:19.758 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:20.514 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:21.271 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.027 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.785 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:23.542 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:24.299 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:25.057 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:25.815 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:26.570 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:27.324 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:28.081 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:29.036 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:29.790 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:30.544 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:31.298 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:32.214 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:33.432 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:34.649 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:35.867 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due, potion_of_prolonged_power
0:36.781 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, potion_of_prolonged_power
0:37.699 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, potion_of_prolonged_power
0:38.615 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, potion_of_prolonged_power
0:39.834 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:40.652 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:41.467 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.877 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.936 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.995 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.407 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.467 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.880 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.940 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.352 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.412 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.824 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:55.207 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.590 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:57.910 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:59.231 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.243 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.254 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.265 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.276 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.287 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.634 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.183 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:08.221 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:09.257 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:10.639 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:11.676 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:13.058 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:14.117 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:15.175 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.234 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.293 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.705 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.116 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.528 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.940 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.352 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.412 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.471 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.883 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.297 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.707 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.117 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.529 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.939 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.998 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.409 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.467 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.467 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:39.877 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:41.289 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
1:42.349 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
1:43.761 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
1:44.516 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
1:45.269 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
1:46.252 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:47.006 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:47.970 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:48.725 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:49.690 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:50.652 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:51.406 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:52.367 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:53.349 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:54.331 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:55.313 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:56.970 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:58.631 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:00.292 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:01.537 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:01.537 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:02.783 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:04.029 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.088 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.146 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.558 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.969 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.352 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:11.390 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:12.771 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
2:13.811 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:15.222 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
2:16.283 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
2:17.342 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
2:18.401 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:19.812 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.223 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:22.567 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:23.914 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:25.260 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:26.607 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.618 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:28.939 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:30.260 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:31.579 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:32.961 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:34.373 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:35.785 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:37.132 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:38.477 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.823 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.834 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.180 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.526 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.872 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:45.883 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:46.891 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:48.303 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:49.714 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:50.776 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:51.835 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:52.895 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:53.953 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.012 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.424 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.837 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.250 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.662 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.720 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.131 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.142 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.489 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.498 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.509 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.521 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.867 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.215 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:12.534 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:13.525 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:14.907 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:16.511 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:17.550 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.898 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:19.910 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:21.256 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:22.267 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:23.278 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:24.290 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:25.635 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:26.646 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.993 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.056 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.468 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.878 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.290 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.703 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.763 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.176 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.236 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.647 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.707 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.461 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.873 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:44.285 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:45.344 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:46.756 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:48.169 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:49.153 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:50.114 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:50.870 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:51.624 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:52.381 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw
3:53.345 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw
3:54.101 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:55.064 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:55.819 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:56.803 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:57.786 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:58.540 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:59.522 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:00.503 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:02.165 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:02.165 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:03.825 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:05.485 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:06.731 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:07.977 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:09.224 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.635 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.048 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.057 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.068 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:15.006 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:15.760 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:16.515 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:17.269 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:18.206 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:18.961 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:19.898 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:21.048 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
4:21.804 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
4:22.741 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
4:23.496 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:24.251 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
4:25.233 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due
4:26.480 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:28.141 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:29.800 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:31.460 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:32.707 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:33.955 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.365 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.775 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.186 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.599 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:40.982 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.365 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.403 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.786 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:46.172 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.582 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.640 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.052 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.463 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.003 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.414 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:55.825 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:56.885 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:57.943 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:59.004 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ctt_nature"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:5:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

ea_es : 1085262 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1085262.0 1085262.0 868.4 / 0.080% 163613.9 / 15.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ea_es 1085262
Earth Shock 107580 9.9% 16.4 17.60sec 1967803 2032981 Direct 16.4 1388723 3843244 1967887 23.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.39 16.39 0.00 0.00 0.9680 0.0000 32251207.08 32251207.08 0.00 2032980.78 2032980.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.52 76.41% 1388723.42 1174217 1623627 1389177.88 1286491 1503803 17390657 17390657 0.00
crit 3.87 23.59% 3843244.35 3250233 4494199 3790611.56 0 4494199 14860550 14860550 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60260 (92165) 5.6% (8.5%) 22.1 13.76sec 1251119 943737 Direct 22.0 582304 1611880 819880 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.04 0.00 0.00 1.3257 0.0000 18065838.64 18065838.64 0.00 943736.53 943736.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.95 76.93% 582303.58 521261 640038 582446.82 553960 609749 9870653 9870653 0.00
crit 5.08 23.07% 1611879.74 1442850 1771626 1605110.48 0 1771626 8195185 8195185 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 31905 2.9% 14.0 21.09sec 685142 0 Direct 13.9 489184 1353430 686650 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.97 13.93 0.00 0.00 0.0000 0.0000 9568654.50 9568654.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.75 77.15% 489183.69 437859 537632 489317.03 454001 519329 5258985 5258985 0.00
crit 3.18 22.85% 1353430.06 1211994 1488166 1309047.33 0 1488166 4309670 4309670 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 121097 11.1% 11.2 27.77sec 3226971 3362535 Direct 11.2 86450 243121 202759 74.2%  
Periodic 236.3 47601 181676 143616 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.34 236.34 0.9597 1.2618 36217865.48 36217865.48 0.00 117214.85 3362535.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.89 25.76% 86450.12 77837 95573 85549.97 0 95573 249963 249963 0.00
crit 8.33 74.24% 243120.58 215453 264547 243167.72 228466 255882 2025691 2025691 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.1 28.39% 47601.13 34 52566 47592.89 43903 49972 3193378 3193378 0.00
crit 169.3 71.61% 181676.15 132 203705 181772.65 171156 189824 30748834 30748834 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 118061 10.9% 38.3 7.54sec 923602 966631 Direct 38.3 652347 1805852 923616 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.31 38.31 0.00 0.00 0.9555 0.0000 35384495.60 35384495.60 0.00 966631.03 966631.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.30 76.48% 652346.55 539032 724039 652635.29 626244 687600 19115147 19115147 0.00
crit 9.01 23.52% 1805851.77 1632219 2004141 1805353.64 0 2004141 16269349 16269349 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 33862 (51944) 3.1% (4.8%) 9.7 32.16sec 1607184 1262761 Direct 9.7 740328 2051697 1050318 23.6%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.66 0.00 0.00 1.2728 0.0000 10149427.61 10149427.61 0.00 1262761.00 1262761.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.38 76.36% 740327.77 663371 814530 740549.82 675234 814530 5463171 5463171 0.00
crit 2.28 23.64% 2051697.34 1836210 2254619 1895075.84 0 2254619 4686256 4686256 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18082 1.7% 6.2 46.67sec 875695 0 Direct 6.2 621853 1724355 877877 23.2%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.19 6.17 0.00 0.00 0.0000 0.0000 5419152.79 5419152.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.74 76.78% 621852.86 557231 684205 620469.78 0 684205 2947737 2947737 0.00
crit 1.43 23.22% 1724354.91 1542417 1893880 1357066.16 0 1893880 2471416 2471416 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 149717 (234719) 13.8% (21.7%) 59.0 5.05sec 1192568 1022078 Direct 58.9 0 762503 762503 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.02 58.88 0.00 0.00 1.1668 0.0000 44894514.95 44894514.95 0.00 1022078.47 1022078.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.88 100.00% 762503.42 692614 850437 762609.99 737689 786424 44894515 44894515 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 76893 7.1% 37.6 7.87sec 614050 0 Direct 37.4 0 615980 615980 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.55 37.43 0.00 0.00 0.0000 0.0000 23058933.15 23058933.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.43 100.00% 615980.05 559584 687093 616085.10 592086 643489 23058933 23058933 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8109 0.7% 43.8 6.18sec 55480 0 Direct 43.8 44709 91204 55480 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.84 43.84 0.00 0.00 0.0000 0.0000 2431985.89 2431985.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.68 76.83% 44709.04 42943 47934 44720.64 43135 47134 1505840 1505840 0.00
crit 10.15 23.17% 91203.92 87603 97785 91195.05 0 97785 926145 926145 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103153 (188908) 9.5% (17.4%) 96.3 3.03sec 588145 489692 Direct 96.3 227140 631586 321139 23.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.25 96.25 0.00 0.00 1.2011 0.0000 30910706.29 30910706.29 0.00 489691.80 489691.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.88 76.76% 227140.31 154272 568274 227400.31 195140 263722 16782173 16782173 0.00
crit 22.37 23.24% 631586.28 427024 1572984 632329.97 457591 972834 14128533 14128533 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 85755 7.9% 93.6 3.79sec 274473 0 Direct 93.6 193935 539245 274466 23.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.63 93.63 0.00 0.00 0.0000 0.0000 25700114.23 25700114.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.80 76.68% 193935.02 129588 477350 193985.92 151537 245915 13924245 13924245 0.00
crit 21.84 23.32% 539245.24 358700 1321306 539477.15 386432 902524 11775869 11775869 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59390) 0.0% (5.4%) 3.0 120.39sec 5926116 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.67 0.00 0.0000 1.0000 0.00 0.00 0.00 306631.05 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19020 1.7% 37.6 6.98sec 150710 0 Direct 37.4 121869 248614 151345 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.57 37.41 0.00 0.00 0.0000 0.0000 5661820.97 5661820.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.71 76.74% 121869.49 121869 121869 121869.49 121869 121869 3498691 3498691 0.00
crit 8.70 23.26% 248613.77 248614 248614 248585.45 0 248614 2163130 2163130 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40370 3.7% 98.5 2.61sec 122056 0 Direct 98.2 98655 201256 122369 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.48 98.23 0.00 0.00 0.0000 0.0000 12020671.75 12020671.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.53 76.89% 98654.92 98655 98655 98654.92 98655 98655 7451295 7451295 0.00
crit 22.70 23.11% 201256.04 201256 201256 201256.04 201256 201256 4569376 4569376 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 136667 / 84823
Fire Blast 136667 7.8% 98.1 2.96sec 257919 139085 Direct 98.1 209411 418830 257919 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.13 98.13 0.00 0.00 1.8544 0.0000 25309470.15 25309470.15 0.00 139085.18 139085.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.40 76.84% 209411.18 199011 222144 209455.82 204520 215963 15789307 15789307 0.00
crit 22.73 23.16% 418830.44 398022 444288 418922.11 404695 436221 9520164 9520164 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186817 / 26575
Lightning Blast 186817 2.4% 42.0 6.74sec 189369 202637 Direct 42.0 153598 307249 189374 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.99 41.99 0.00 0.00 0.9345 0.0000 7952503.70 7952503.70 0.00 202637.37 202637.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.22 76.72% 153597.82 147415 164551 153629.68 148813 161763 4948635 4948635 0.00
crit 9.78 23.28% 307248.89 294831 329102 307315.03 294831 329102 3003868 3003868 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ea_es
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.75sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0235 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8212 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.00sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.21 0.00 0.00 0.00 0.5219 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 13.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.14% 32.14% 3.1(3.1) 8.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.75% 8.75% 0.0(0.0) 3.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.75%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.5 27.1sec 23.5sec 35.01% 35.01% 1.5(1.5) 10.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:35.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.5 27.2sec 23.6sec 34.82% 34.82% 1.5(1.5) 10.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.7 28.0sec 23.6sec 33.67% 33.67% 1.7(1.7) 9.9

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.9 26.5 4.2sec 3.0sec 59.26% 61.26% 26.5(32.5) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.64%
  • elemental_focus_2:33.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.61% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.42%
  • icefury_2:5.93%
  • icefury_3:5.02%
  • icefury_4:3.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.4 13.0sec 12.2sec 10.35% 39.70% 1.4(1.4) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.35%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.1 23.1sec 17.2sec 29.81% 29.81% 4.1(4.1) 12.6

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.2sec 69.2sec 13.59% 13.59% 0.0(0.0) 3.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.59%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.0sec 0.0sec 39.93% 39.93% 0.0(0.0) 2.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.4 1.4 37.0sec 30.4sec 21.84% 24.04% 1.4(2.9) 0.1

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.17%
  • power_of_the_maelstrom_2:6.31%
  • power_of_the_maelstrom_3:9.36%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.46% 8.91% 0.0(0.0) 0.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.28%
  • stormkeeper_2:3.66%
  • stormkeeper_3:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.21% 2.2(2.2) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 79.1sec
Lava Surge: During Lava Burst 3.7 58.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6880.0014.6402.4820.0009.203
Fire Elemental0.4990.0011.7410.5500.0003.837
Lava Burst0.9090.0018.6757.4140.02327.445
Elemental Blast0.5410.0014.4928.9882.64618.146
Icefury1.0170.0018.9767.4460.18122.716

Resources

Resource Usage Type Count Total Average RPE APR
ea_es
earth_shock Maelstrom 118.9 14264.4 119.9 870.3 2261.0
flame_shock Maelstrom 81.4 1453.3 17.8 129.5 24920.8
frost_shock Maelstrom 278.0 5559.9 20.0 145.1 6364.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 428.25 5083.68 (23.46%) 11.87 55.26 1.08%
Lava Burst Overload Maelstrom 272.48 2364.03 (10.91%) 8.68 88.25 3.60%
Lightning Bolt Maelstrom 698.40 5572.42 (25.71%) 7.98 14.76 0.26%
Lightning Bolt Overload Maelstrom 679.41 4029.12 (18.59%) 5.93 47.33 1.16%
Icefury Maelstrom 70.29 1676.34 (7.74%) 23.85 10.61 0.63%
Icefury Overload Maelstrom 44.91 799.50 (3.69%) 17.80 8.81 1.09%
Resonance Totem Maelstrom 2165.75 2145.20 (9.90%) 0.99 20.55 0.95%
Resource RPS-Gain RPS-Loss
Maelstrom 9.95 9.77
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.52 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ea_es Fight Length
Count 8779
Mean 300.02
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.6249
5th Percentile 245.25
95th Percentile 354.75
( 95th Percentile - 5th Percentile ) 109.50
Mean Distribution
Standard Deviation 0.3909
95.00% Confidence Intervall ( 299.25 - 300.78 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 573
0.1% Error 57248
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 46
0.01 Scale Factor Error with Delta=300 1146
DPS
Sample Data ea_es Damage Per Second
Count 8779
Mean 1085262.04
Minimum 934843.74
Maximum 1265175.71
Spread ( max - min ) 330331.97
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 41514.3829
5th Percentile 1020077.26
95th Percentile 1157338.71
( 95th Percentile - 5th Percentile ) 137261.45
Mean Distribution
Standard Deviation 443.0738
95.00% Confidence Intervall ( 1084393.63 - 1086130.45 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5622
0.1 Scale Factor Error with Delta=300 14712310
0.05 Scale Factor Error with Delta=300 58849237
0.01 Scale Factor Error with Delta=300 1471230918
Priority Target DPS
Sample Data ea_es Priority Target Damage Per Second
Count 8779
Mean 1085262.04
Minimum 934843.74
Maximum 1265175.71
Spread ( max - min ) 330331.97
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 41514.3829
5th Percentile 1020077.26
95th Percentile 1157338.71
( 95th Percentile - 5th Percentile ) 137261.45
Mean Distribution
Standard Deviation 443.0738
95.00% Confidence Intervall ( 1084393.63 - 1086130.45 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5622
0.1 Scale Factor Error with Delta=300 14712310
0.05 Scale Factor Error with Delta=300 58849237
0.01 Scale Factor Error with Delta=300 1471230918
DPS(e)
Sample Data ea_es Damage Per Second (Effective)
Count 8779
Mean 1085262.04
Minimum 934843.74
Maximum 1265175.71
Spread ( max - min ) 330331.97
Range [ ( max - min ) / 2 * 100% ] 15.22%
Damage
Sample Data ea_es Damage
Count 8779
Mean 291735388.93
Minimum 201658699.08
Maximum 380653267.66
Spread ( max - min ) 178994568.58
Range [ ( max - min ) / 2 * 100% ] 30.68%
DTPS
Sample Data ea_es Damage Taken Per Second
Count 8779
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ea_es Healing Per Second
Count 8779
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ea_es Healing Per Second (Effective)
Count 8779
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ea_es Heal
Count 8779
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ea_es Healing Taken Per Second
Count 8779
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ea_es Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ea_esTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ea_es Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.03 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.17 totem_mastery,if=buff.resonance_totem.remains<2
9 3.47 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.06 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.55 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.56 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.78 elemental_blast
Keep your EB always on Cooldown.
I 12.53 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.52 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 10.00 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.71 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.79 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.78 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.98 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.30 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.09 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 19.09 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 75.40 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMLLGLGMGMNOSHMSIMRRRSSSMISHMSSMKMGNNNSSSHMFSSIMSSSHSMJLILLKMNNHNNSMFMRRRMHSPSSMMS97SSHIKMNNRNNFMRRSQHMMOSMIASJMMHMSSSSMIKNMNHMNNOSSSMSSHMSMIMSSSMKGHNNNMSOSSSMHJSISSMSSSSHM9IKMNNMMNNHMFSMSSSSPMHQSMSMRKGNNNHMMAORRJLIMSSHSMSSPSSMKHMGNMNFNRMMMHIRRSMSSSSSHIKMMN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.960 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.025 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.090 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.155 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.954 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.753 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:08.553 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:09.353 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:10.169 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:10.985 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:11.802 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:12.890 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:13.707 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.524 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:15.590 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.656 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.421 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.437 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.202 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.219 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.253 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.290 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.327 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.365 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.402 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.439 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.476 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.291 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.377 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.462 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.279 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.367 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.432 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.229 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.294 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:36.360 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:37.161 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:37.961 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:38.778 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:39.593 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.679 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.765 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.177 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.588 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.000 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.061 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.474 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.887 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.946 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.357 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.768 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.179 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.592 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.004 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.350 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.698 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.707 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.718 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.727 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.737 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.747 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.093 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:08.439 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:09.497 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:10.556 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:11.966 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:12.978 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:13.990 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.336 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.683 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.693 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.704 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.049 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:21.397 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:22.717 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:24.101 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:25.484 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:26.867 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.926 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.337 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.750 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:32.161 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:33.220 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.632 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.692 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.692 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.104 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:38.516 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:39.499 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:40.253 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:41.235 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
1:42.219 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
1:42.974 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
1:43.728 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
1:44.710 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
1:45.466 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
1:46.222 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:46.978 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:47.960 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:48.942 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:49.925 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:50.909 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
1:51.743 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
1:53.403 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
1:54.649 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
1:56.235 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:57.422 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:59.007 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.017 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.028 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.028 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.374 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.382 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.394 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.453 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.864 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.249 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:09.241 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.232 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:11.223 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:12.542 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:13.862 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.872 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.218 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:17.229 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:18.241 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
2:19.279 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:20.664 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:22.048 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:23.042 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
2:24.033 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.044 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.389 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.733 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.080 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.425 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.770 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:33.154 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:34.538 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:35.576 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:36.960 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.345 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.405 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.463 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.875 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:43.258 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:44.642 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.027 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.599 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
2:48.638 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
2:50.022 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
2:51.059 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
2:52.051 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
2:53.043 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:54.365 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.712 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.705 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:58.026 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.347 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.668 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:02.051 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:03.433 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:04.472 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.510 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.570 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.608 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.647 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.030 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.413 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.798 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.209 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.620 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.034 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.380 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.391 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.400 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.747 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:22.755 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:23.767 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:24.777 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:25.787 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:27.135 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:28.197 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:29.256 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.667 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.659 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.650 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.970 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:35.291 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.610 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.957 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.303 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.651 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.662 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.073 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.485 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.240 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.587 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.598 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.944 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.292 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.637 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.089 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:54.102 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:55.113 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:56.173 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:57.234 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.644 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.991 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.002 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.002 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.012 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.359 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.706 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.717 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.727 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.737 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.083 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.141 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.202 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.614 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.027 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.437 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.847 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.260 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:19.321 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.733 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:22.116 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:23.498 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:24.881 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:26.265 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:27.305 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:28.317 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:29.329 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:30.676 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:31.685 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:32.694 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:33.707 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.054 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.066 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.075 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.485 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.897 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.907 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.254 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.600 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.920 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:46.240 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:47.560 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:48.880 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:50.200 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.611 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.021 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.434 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.443 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.789 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:57.781 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:59.102 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ea_es"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:5:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

ede_crit : 1093431 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1093431.1 1093431.1 874.6 / 0.080% 164529.8 / 15.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ede_crit 1093431
Earth Shock 104650 9.6% 16.4 17.61sec 1912459 1975937 Direct 16.4 1342881 3787800 1912301 23.3%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.41 16.41 0.00 0.00 0.9679 0.0000 31381829.08 31381829.08 0.00 1975936.85 1975936.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.59 76.70% 1342881.21 1135077 1569506 1343267.81 1241298 1461093 16902098 16902098 0.00
crit 3.82 23.30% 3787800.17 3200916 4426007 3739612.79 0 4426007 14479731 14479731 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60767 (93064) 5.6% (8.5%) 22.1 13.76sec 1263714 953583 Direct 22.0 582529 1642566 827300 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.03 0.00 0.00 1.3253 0.0000 18225828.49 18225828.49 0.00 953582.70 953582.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.94 76.91% 582529.09 521261 640038 582687.71 552407 620043 9870074 9870074 0.00
crit 5.09 23.09% 1642565.81 1469956 1804908 1637266.25 0 1804908 8355755 8355755 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 32298 3.0% 14.0 20.98sec 692603 0 Direct 13.9 489247 1380485 694263 23.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.98 13.95 0.00 0.00 0.0000 0.0000 9681722.82 9681722.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.74 77.00% 489246.50 437859 537632 489429.03 453700 525327 5253578 5253578 0.00
crit 3.21 23.00% 1380484.98 1234763 1516123 1337334.55 0 1516123 4428145 4428145 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 123093 11.2% 11.2 27.79sec 3281727 3419569 Direct 11.2 86449 247616 205987 74.2%  
Periodic 236.4 47597 185061 145961 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.41 236.41 0.9598 1.2613 36818496.42 36818496.42 0.00 119165.67 3419568.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.90 25.83% 86448.71 77837 95573 85504.33 0 95573 250560 250560 0.00
crit 8.32 74.17% 247615.67 219500 269516 247664.74 233084 259633 2060380 2060380 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.2 28.44% 47597.28 37 52566 47591.04 43812 49671 3200605 3200605 0.00
crit 169.2 71.56% 185060.70 107 207532 185161.11 174982 193122 31306951 31306951 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 119158 10.9% 38.3 7.54sec 931466 975247 Direct 38.3 652310 1840053 931449 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.34 38.34 0.00 0.00 0.9551 0.0000 35715480.68 35715480.68 0.00 975246.59 975246.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.33 76.50% 652309.74 501223 724039 652605.84 616123 686449 19133248 19133248 0.00
crit 9.01 23.50% 1840052.76 1662882 2041791 1839664.72 0 2041791 16582232 16582232 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 34071 (52306) 3.1% (4.8%) 9.7 32.15sec 1617632 1271837 Direct 9.7 740188 2089021 1056505 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2719 0.0000 10213309.20 10213309.20 0.00 1271836.90 1271836.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.40 76.55% 740187.51 663371 814530 740362.62 673257 803655 5478197 5478197 0.00
crit 2.27 23.45% 2089021.28 1870706 2296974 1923519.51 0 2296974 4735112 4735112 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18236 1.7% 6.2 47.34sec 883464 0 Direct 6.2 621946 1754495 885409 23.3%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.18 6.17 0.00 0.00 0.0000 0.0000 5463352.40 5463352.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.73 76.74% 621946.37 557231 684205 621059.35 0 684205 2944758 2944758 0.00
crit 1.44 23.26% 1754495.01 1571393 1929459 1382860.64 0 1929459 2518595 2518595 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 153002 (239578) 14.0% (21.9%) 59.1 5.02sec 1214808 1041585 Direct 59.0 0 777606 777606 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.14 59.00 0.00 0.00 1.1663 0.0000 45880256.89 45880256.89 0.00 1041585.04 1041585.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.00 100.00% 777606.22 706308 867251 777714.63 756919 805006 45880257 45880257 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 78438 7.2% 37.6 7.88sec 625037 0 Direct 37.5 0 626961 626961 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.64 37.52 0.00 0.00 0.0000 0.0000 23524860.10 23524860.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.52 100.00% 626960.77 569500 699269 627054.82 603405 653402 23524860 23524860 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8138 0.7% 44.0 6.19sec 55473 0 Direct 44.0 44713 91206 55472 23.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.99 43.99 0.00 0.00 0.0000 0.0000 2440294.61 2440294.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.81 76.86% 44712.63 42943 47934 44723.45 43217 46935 1511701 1511701 0.00
crit 10.18 23.14% 91205.70 87603 97785 91179.82 0 97785 928594 928594 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103942 (190614) 9.5% (17.4%) 96.2 3.04sec 593979 494736 Direct 96.2 227381 642677 323872 23.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.18 96.18 0.00 0.00 1.2006 0.0000 31148859.92 31148859.92 0.00 494736.08 494736.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.83 76.77% 227381.39 154272 568274 227591.70 193505 266557 16787708 16787708 0.00
crit 22.35 23.23% 642676.51 435046 1602534 643183.95 468047 968333 14361152 14361152 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 86671 7.9% 93.9 3.80sec 276573 0 Direct 93.9 194103 549835 276574 23.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.93 93.93 0.00 0.00 0.0000 0.0000 25977820.46 25977820.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.15 76.82% 194103.17 129588 477350 194174.05 154800 246911 14005872 14005872 0.00
crit 21.77 23.18% 549834.94 365439 1346128 549954.84 392603 896454 11971949 11971949 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59656) 0.0% (5.4%) 3.0 120.39sec 5950153 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.94 0.00 0.0000 1.0000 0.00 0.00 0.00 306593.29 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19092 1.7% 37.7 6.98sec 150764 0 Direct 37.6 121869 248614 151352 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.70 37.55 0.00 0.00 0.0000 0.0000 5683277.49 5683277.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.82 76.74% 121869.49 121869 121869 121869.49 121869 121869 3511719 3511719 0.00
crit 8.73 23.26% 248613.77 248614 248614 248613.77 248614 248614 2171558 2171558 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40564 3.7% 99.0 2.61sec 122043 0 Direct 98.7 98655 201256 122338 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.97 98.74 0.00 0.00 0.0000 0.0000 12079204.73 12079204.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.95 76.92% 98654.92 98655 98655 98654.92 98655 98655 7492441 7492441 0.00
crit 22.79 23.08% 201256.04 201256 201256 201256.04 201256 201256 4586764 4586764 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 136673 / 84720
Fire Blast 136673 7.7% 98.0 2.95sec 257829 139100 Direct 98.0 209418 418877 257833 23.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.05 98.05 0.00 0.00 1.8536 0.0000 25279886.92 25279886.92 0.00 139099.96 139099.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.39 76.89% 209417.55 199011 222144 209462.02 205011 215675 15787385 15787385 0.00
crit 22.66 23.11% 418877.32 398022 444288 418967.78 405140 434628 9492502 9492502 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186467 / 26591
Lightning Blast 186467 2.4% 42.1 6.72sec 189120 202303 Direct 42.1 153613 307241 189120 23.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.09 42.09 0.00 0.00 0.9348 0.0000 7960232.16 7960232.16 0.00 202303.35 202303.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.36 76.89% 153612.78 147415 164551 153646.89 149063 160966 4971306 4971306 0.00
crit 9.73 23.11% 307240.88 294831 329102 307340.39 294831 329102 2988926 2988926 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ede_crit
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.79sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0222 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 0.00 0.00 0.8218 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.03sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.19 0.00 0.00 0.00 0.5209 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 24.9sec 32.18% 32.18% 3.1(3.1) 8.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.5sec 68.5sec 8.77% 8.77% 0.0(0.0) 3.2

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.77%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.4sec 23.9sec 34.55% 34.55% 1.4(1.4) 10.1

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.0sec 23.5sec 35.03% 35.03% 1.4(1.4) 10.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:35.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.8sec 23.3sec 34.04% 34.04% 1.8(1.8) 10.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:34.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.9 26.6 4.2sec 3.0sec 59.21% 61.25% 26.6(32.6) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.64%
  • elemental_focus_2:33.57%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.60% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.38%
  • icefury_2:5.95%
  • icefury_3:5.04%
  • icefury_4:3.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 12.9sec 12.2sec 10.40% 39.82% 1.4(1.4) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.40%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.2sec 29.84% 29.84% 4.2(4.2) 12.6

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 68.8sec 68.8sec 13.63% 13.63% 0.0(0.0) 3.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.63%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.0sec 0.0sec 39.90% 39.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.6sec 30.2sec 21.98% 24.23% 1.4(3.0) 0.1

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.23%
  • power_of_the_maelstrom_2:6.34%
  • power_of_the_maelstrom_3:9.41%

Trigger Attempt Success

  • trigger_pct:15.08%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.50% 8.92% 0.0(0.0) 0.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.25%
  • stormkeeper_2:3.69%
  • stormkeeper_3:4.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 79.1sec
Lava Surge: During Lava Burst 3.7 57.8sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6860.0014.4982.4860.0008.658
Fire Elemental0.4910.0011.7240.5440.0003.495
Lava Burst0.9030.0019.3287.4180.00026.533
Elemental Blast0.5390.0014.4918.9721.52919.676
Icefury1.0150.0018.6607.4190.38924.479

Resources

Resource Usage Type Count Total Average RPE APR
ede_crit
earth_shock Maelstrom 132.8 15929.0 120.0 970.7 1970.1
flame_shock Maelstrom 90.8 1620.3 17.9 144.4 22723.7
frost_shock Maelstrom 310.2 6204.4 20.0 161.8 5756.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 478.50 5680.76 (23.49%) 11.87 61.28 1.07%
Lava Burst Overload Maelstrom 304.52 2640.21 (10.92%) 8.67 100.51 3.67%
Lightning Bolt Maelstrom 778.09 6207.85 (25.67%) 7.98 16.87 0.27%
Lightning Bolt Overload Maelstrom 759.90 4505.79 (18.63%) 5.93 53.59 1.18%
Icefury Maelstrom 78.41 1870.50 (7.73%) 23.86 11.32 0.60%
Icefury Overload Maelstrom 50.03 890.36 (3.68%) 17.80 10.18 1.13%
Resonance Totem Maelstrom 2414.81 2391.47 (9.89%) 0.99 23.34 0.97%
Resource RPS-Gain RPS-Loss
Maelstrom 9.96 9.79
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 52.21 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ede_crit Fight Length
Count 8657
Mean 300.01
Minimum 239.98
Maximum 360.00
Spread ( max - min ) 120.02
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.5666
5th Percentile 246.19
95th Percentile 353.82
( 95th Percentile - 5th Percentile ) 107.63
Mean Distribution
Standard Deviation 0.3823
95.00% Confidence Intervall ( 299.26 - 300.75 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 540
0.1% Error 53992
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 44
0.01 Scale Factor Error with Delta=300 1080
DPS
Sample Data ede_crit Damage Per Second
Count 8657
Mean 1093431.15
Minimum 962993.97
Maximum 1256344.51
Spread ( max - min ) 293350.54
Range [ ( max - min ) / 2 * 100% ] 13.41%
Standard Deviation 41517.3269
5th Percentile 1027865.21
95th Percentile 1165407.27
( 95th Percentile - 5th Percentile ) 137542.06
Mean Distribution
Standard Deviation 446.2166
95.00% Confidence Intervall ( 1092556.58 - 1094305.71 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5539
0.1 Scale Factor Error with Delta=300 14714396
0.05 Scale Factor Error with Delta=300 58857584
0.01 Scale Factor Error with Delta=300 1471439585
Priority Target DPS
Sample Data ede_crit Priority Target Damage Per Second
Count 8657
Mean 1093431.15
Minimum 962993.97
Maximum 1256344.51
Spread ( max - min ) 293350.54
Range [ ( max - min ) / 2 * 100% ] 13.41%
Standard Deviation 41517.3269
5th Percentile 1027865.21
95th Percentile 1165407.27
( 95th Percentile - 5th Percentile ) 137542.06
Mean Distribution
Standard Deviation 446.2166
95.00% Confidence Intervall ( 1092556.58 - 1094305.71 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5539
0.1 Scale Factor Error with Delta=300 14714396
0.05 Scale Factor Error with Delta=300 58857584
0.01 Scale Factor Error with Delta=300 1471439585
DPS(e)
Sample Data ede_crit Damage Per Second (Effective)
Count 8657
Mean 1093431.15
Minimum 962993.97
Maximum 1256344.51
Spread ( max - min ) 293350.54
Range [ ( max - min ) / 2 * 100% ] 13.41%
Damage
Sample Data ede_crit Damage
Count 8657
Mean 294234593.30
Minimum 213603148.03
Maximum 379495458.78
Spread ( max - min ) 165892310.75
Range [ ( max - min ) / 2 * 100% ] 28.19%
DTPS
Sample Data ede_crit Damage Taken Per Second
Count 8657
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ede_crit Healing Per Second
Count 8657
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ede_crit Healing Per Second (Effective)
Count 8657
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ede_crit Heal
Count 8657
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ede_crit Healing Taken Per Second
Count 8657
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ede_crit Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ede_critTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ede_crit Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.01 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.18 totem_mastery,if=buff.resonance_totem.remains<2
9 3.42 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.02 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.50 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.50 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.46 elemental_blast
Keep your EB always on Cooldown.
I 12.40 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.47 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.86 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.68 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.06 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.33 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.86 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.22 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.04 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.96 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 74.11 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMLLLGMGNNSSSMMIHFSSSMSSSSISSSHMMSOSSKGGMGMGRHPRMRSSSSMIHSMJMFSKNNNMHNMSMSMISSSSHMOSSSMPRKHMMGNNNRM97MQHRSIMMOAJMMSHMKGGMGNSSISHMSSSMOSSSHIMSSSKMGMGHGNSMMMISSOSHMJSSSMMIRKNHMNNNRRSMMORMP9HRMMRSMSIMSHKNNMN8NSMSMHOSSASMJILLLHMMSSPKNSMMHNNNSSOSMMRRRSIHMSSSSSMSIHKMMNNMNN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.943 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:03.698 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:04.451 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.204 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.958 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:06.712 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:07.467 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.221 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.976 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:09.731 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:10.487 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:11.242 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:11.997 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:12.749 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:13.504 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:14.258 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:15.217 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:16.495 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:17.456 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:18.735 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:20.013 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:21.292 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:22.570 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:23.328 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:24.084 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:24.840 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:25.597 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:26.350 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:27.107 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:27.863 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:28.621 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:29.379 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:30.137 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:30.893 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:31.650 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:32.404 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:33.160 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:33.915 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:34.672 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:35.631 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, potion_of_prolonged_power
0:36.590 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, potion_of_prolonged_power
0:37.549 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, potion_of_prolonged_power
0:38.510 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:39.761 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:40.703 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:41.955 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:43.583 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.575 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.895 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.215 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.536 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.857 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.177 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:52.499 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:53.819 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:55.203 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.262 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.675 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:59.059 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:00.098 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.137 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.519 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.557 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.596 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.049 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:07.090 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:08.153 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:09.210 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:10.621 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:12.030 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:13.090 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.100 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.111 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.122 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.132 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.478 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.488 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.834 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.182 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.529 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.940 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.350 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.762 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.821 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.232 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.645 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.056 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:34.468 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:35.528 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:36.939 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:38.349 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:39.762 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:40.820 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:42.232 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:43.291 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:44.350 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:45.409 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:46.470 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.881 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.939 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.061 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.061 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.473 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.228 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:53.612 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.996 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.380 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:57.417 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.456 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.841 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.901 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.901 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.192 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.253 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.665 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.725 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.137 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.196 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.691 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:10.700 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:11.711 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:13.057 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:14.068 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:15.078 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.088 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.079 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:18.070 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:19.452 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:20.836 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.156 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.505 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.853 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.199 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.545 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.556 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.901 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.247 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:32.630 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:34.216 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:35.208 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:36.528 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:37.849 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:39.169 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:40.515 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:41.861 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:42.871 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:43.882 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:45.227 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:46.287 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:47.697 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:48.755 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:49.766 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:51.112 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:52.102 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:53.423 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:54.414 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:55.406 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.727 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:58.050 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.040 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.424 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.836 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.184 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.195 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.205 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.216 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.227 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.575 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.585 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.596 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.943 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.355 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:14.416 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:15.828 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:17.174 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:18.184 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:19.194 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:20.207 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:21.144 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:22.083 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:23.019 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:23.773 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:24.710 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:25.465 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:26.402 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:27.158 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:27.911 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:28.666 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:29.629 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:30.548 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:31.303 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:32.856 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:34.411 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:35.994 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:37.184 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:38.767 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:39.933 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:41.254 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.638 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:44.022 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:45.342 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:46.334 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:47.324 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:48.671 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:49.682 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:50.435 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:51.444 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.789 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.798 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.144 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.557 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.966 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.025 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.437 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.820 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.820 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:03.202 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:04.586 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:05.624 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:06.662 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.722 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.782 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:09.822 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.348 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.339 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.661 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:14.982 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.301 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:17.290 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:18.610 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:19.620 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:20.967 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:21.975 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:23.387 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
4:24.371 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
4:25.127 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:25.881 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
4:26.636 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:27.574 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:28.512 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:29.267 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:30.202 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:30.956 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:31.892 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:32.809 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:33.728 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:34.647 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:35.567 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:36.788 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:38.415 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:39.969 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:41.523 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:43.077 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.397 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:45.718 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:47.039 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:48.359 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:49.679 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.740 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.153 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.498 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:54.509 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:55.856 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:56.866 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:57.875 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:58.884 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:59.895 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ede_crit"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:5:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

edi_cl : 1081401 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1081401.1 1081401.1 864.4 / 0.080% 159519.9 / 14.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
edi_cl 1081401
Earth Shock 103699 9.6% 16.4 17.60sec 1899098 1961598 Direct 16.4 1341964 3719224 1899089 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.38 16.38 0.00 0.00 0.9681 0.0000 31107023.34 31107023.34 0.00 1961598.14 1961598.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.54 76.56% 1341963.62 1135077 1569506 1342335.10 1254451 1462320 16829790 16829790 0.00
crit 3.84 23.44% 3719224.44 3141892 4344393 3657130.56 0 4344393 14277233 14277233 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60128 (92097) 5.6% (8.5%) 22.1 13.76sec 1250934 943751 Direct 22.0 582397 1611505 818632 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.03 0.00 0.00 1.3255 0.0000 18029579.40 18029579.40 0.00 943751.06 943751.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.97 77.05% 582397.29 521261 640038 582557.92 554600 614453 9883351 9883351 0.00
crit 5.06 22.95% 1611504.68 1442850 1771626 1606674.25 0 1771626 8146229 8146229 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 31969 3.0% 13.9 21.29sec 687203 0 Direct 13.9 489072 1353685 688740 23.1%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.95 13.92 0.00 0.00 0.0000 0.0000 9586464.02 9586464.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.70 76.90% 489072.15 437859 537632 489196.96 446616 526866 5234948 5234948 0.00
crit 3.21 23.10% 1353684.79 1211994 1488166 1305522.41 0 1488166 4351516 4351516 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120999 11.2% 11.2 27.78sec 3225213 3360592 Direct 11.2 86390 243048 202837 74.3%  
Periodic 236.3 47578 181658 143494 71.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.34 236.34 0.9597 1.2618 36190217.02 36190217.02 0.00 117128.78 3360592.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.88 25.66% 86390.47 77837 95573 85377.02 0 95573 248792 248792 0.00
crit 8.34 74.34% 243047.55 215453 264547 243099.26 226093 256965 2027297 2027297 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.3 28.46% 47578.29 35 52566 47571.44 43164 49536 3200645 3200645 0.00
crit 169.1 71.54% 181657.85 138 203705 181760.41 171178 190761 30713483 30713483 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 118187 10.9% 38.3 7.55sec 924193 967016 Direct 38.3 652419 1807111 924235 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.33 38.33 0.00 0.00 0.9557 0.0000 35421797.85 35421797.85 0.00 967016.05 967016.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.31 76.46% 652419.02 579231 724039 652721.91 623241 687267 19120136 19120136 0.00
crit 9.02 23.54% 1807110.76 1530352 2004141 1806576.29 0 2004141 16301661 16301661 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 33833 (51867) 3.1% (4.8%) 9.7 32.15sec 1603576 1260034 Direct 9.7 740047 2050262 1048946 23.6%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2727 0.0000 10138000.93 10138000.93 0.00 1260034.02 1260034.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.39 76.43% 740047.29 663371 814530 740251.15 676638 798218 5467284 5467284 0.00
crit 2.28 23.57% 2050262.18 1836210 2254619 1893642.83 0 2254619 4670717 4670717 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18033 1.7% 6.2 47.05sec 875484 0 Direct 6.2 621907 1722216 877635 23.2%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.17 6.15 0.00 0.00 0.0000 0.0000 5401998.64 5401998.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.72 76.75% 621906.96 557231 684205 620607.34 0 684205 2937923 2937923 0.00
crit 1.43 23.25% 1722215.59 1542417 1893880 1345275.26 0 1893880 2464076 2464076 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 149696 (234792) 13.9% (21.7%) 59.0 5.03sec 1192747 1022275 Direct 58.9 0 762466 762466 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.02 58.87 0.00 0.00 1.1668 0.0000 44887043.70 44887043.70 0.00 1022274.71 1022274.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.87 100.00% 762466.12 692614 850437 762581.26 740158 787667 44887044 44887044 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 76974 7.1% 37.6 7.82sec 614109 0 Direct 37.5 0 615952 615952 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.58 37.47 0.00 0.00 0.0000 0.0000 23077616.67 23077616.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.47 100.00% 615952.21 559584 687093 616040.94 593294 642555 23077617 23077617 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8121 0.8% 43.9 6.17sec 55510 0 Direct 43.9 44713 91220 55509 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.85 43.85 0.00 0.00 0.0000 0.0000 2434287.52 2434287.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.67 76.78% 44712.62 42943 47934 44723.16 42943 46905 1505558 1505558 0.00
crit 10.18 23.22% 91219.84 87603 97785 91211.80 0 97785 928729 928729 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103214 (188832) 9.6% (17.5%) 96.3 3.04sec 587985 489614 Direct 96.3 227264 631930 321382 23.3%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.26 96.26 0.00 0.00 1.2009 0.0000 30936039.38 30936039.38 0.00 489613.85 489613.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.87 76.74% 227263.76 154272 568274 227509.54 193535 263751 16787579 16787579 0.00
crit 22.39 23.26% 631929.75 427024 1572984 632358.20 456098 1021125 14148460 14148460 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 85618 7.9% 93.5 3.81sec 274388 0 Direct 93.5 194180 539125 274378 23.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.52 93.52 0.00 0.00 0.0000 0.0000 25660873.48 25660873.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.77 76.75% 194179.57 129588 477350 194239.32 155113 242797 13937015 13937015 0.00
crit 21.75 23.25% 539124.64 358700 1321306 539437.71 383606 810638 11723859 11723859 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59629) 0.0% (5.5%) 3.0 120.38sec 5952682 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.84 0.00 0.0000 1.0000 0.00 0.00 0.00 306894.70 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19085 1.8% 37.7 6.96sec 150688 0 Direct 37.6 121869 248614 151253 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.70 37.56 0.00 0.00 0.0000 0.0000 5680549.44 5680549.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.85 76.81% 121869.49 121869 121869 121869.49 121869 121869 3515653 3515653 0.00
crit 8.71 23.19% 248613.77 248614 248614 248613.77 248614 248614 2164897 2164897 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40544 3.7% 98.9 2.62sec 122097 0 Direct 98.6 98655 201256 122399 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.87 98.62 0.00 0.00 0.0000 0.0000 12071160.61 12071160.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.80 76.86% 98654.92 98655 98655 98654.92 98655 98655 7477672 7477672 0.00
crit 22.82 23.14% 201256.04 201256 201256 201256.04 201256 201256 4593489 4593489 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 136699 / 84709
Fire Blast 136699 7.8% 98.0 2.96sec 257911 139132 Direct 98.0 209438 418910 257908 23.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.00 98.00 0.00 0.00 1.8537 0.0000 25275693.47 25275693.47 0.00 139132.00 139132.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.32 76.86% 209438.32 199011 222144 209483.30 204949 215645 15775628 15775628 0.00
crit 22.68 23.14% 418909.93 398022 444288 418999.51 405003 437170 9500066 9500066 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186478 / 26591
Lightning Blast 186478 2.5% 42.1 6.72sec 189131 202335 Direct 42.1 153605 307252 189128 23.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.08 42.08 0.00 0.00 0.9348 0.0000 7959067.91 7959067.91 0.00 202335.47 202335.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.35 76.88% 153605.13 147415 164551 153642.38 148966 161821 4969400 4969400 0.00
crit 9.73 23.12% 307252.47 294831 329102 307308.44 294831 329102 2989668 2989668 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
edi_cl
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.95sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0237 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 0.00 0.00 0.8217 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.14sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5210 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.1sec 32.16% 32.16% 3.1(3.1) 8.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 69.1sec 69.1sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.3sec 23.7sec 34.81% 34.81% 1.4(1.4) 10.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.5 1.4 27.2sec 23.6sec 34.77% 34.77% 1.4(1.4) 10.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 28.0sec 23.5sec 33.90% 33.90% 1.8(1.8) 9.9

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.9 26.6 4.2sec 3.0sec 59.24% 61.26% 26.6(32.6) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.64%
  • elemental_focus_2:33.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.66% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.43%
  • icefury_2:5.95%
  • icefury_3:5.03%
  • icefury_4:3.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.4 13.0sec 12.2sec 10.36% 39.74% 1.4(1.4) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.36%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.90% 29.90% 4.2(4.2) 12.6

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.5sec 69.5sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.2sec 0.0sec 39.91% 39.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.4 1.4 37.0sec 30.5sec 21.77% 23.96% 1.4(2.9) 0.1

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.09%
  • power_of_the_maelstrom_2:6.31%
  • power_of_the_maelstrom_3:9.36%

Trigger Attempt Success

  • trigger_pct:14.96%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.46% 8.92% 0.0(0.0) 0.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.25%
  • stormkeeper_2:3.66%
  • stormkeeper_3:4.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.18% 2.2(2.2) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 78.3sec
Lava Surge: During Lava Burst 3.7 58.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6900.0014.9612.4910.0008.704
Fire Elemental0.4940.0011.6310.5500.0003.347
Lava Burst0.9080.0018.4947.4440.00026.421
Elemental Blast0.5400.0014.8438.9772.78618.023
Icefury1.0210.0018.3187.4580.91524.463

Resources

Resource Usage Type Count Total Average RPE APR
edi_cl
earth_shock Maelstrom 133.0 15957.8 120.0 974.2 1949.3
flame_shock Maelstrom 91.1 1625.9 17.8 144.9 22258.5
frost_shock Maelstrom 311.3 6225.1 20.0 162.4 5690.2
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 479.29 5688.98 (23.46%) 11.87 62.54 1.09%
Lava Burst Overload Maelstrom 305.15 2647.86 (10.92%) 8.68 98.53 3.59%
Lightning Bolt Maelstrom 781.68 6237.19 (25.72%) 7.98 16.24 0.26%
Lightning Bolt Overload Maelstrom 759.44 4503.68 (18.57%) 5.93 52.99 1.16%
Icefury Maelstrom 78.70 1877.38 (7.74%) 23.86 11.41 0.60%
Icefury Overload Maelstrom 50.11 891.56 (3.68%) 17.79 10.46 1.16%
Resonance Totem Maelstrom 2423.80 2400.69 (9.90%) 0.99 23.11 0.95%
Resource RPS-Gain RPS-Loss
Maelstrom 9.95 9.77
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.09 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data edi_cl Fight Length
Count 8397
Mean 300.01
Minimum 239.99
Maximum 360.01
Spread ( max - min ) 120.02
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.0016
5th Percentile 245.82
95th Percentile 354.20
( 95th Percentile - 5th Percentile ) 108.38
Mean Distribution
Standard Deviation 0.3929
95.00% Confidence Intervall ( 299.23 - 300.78 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 554
0.1% Error 55321
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1107
DPS
Sample Data edi_cl Damage Per Second
Count 8397
Mean 1081401.12
Minimum 959878.35
Maximum 1250506.61
Spread ( max - min ) 290628.26
Range [ ( max - min ) / 2 * 100% ] 13.44%
Standard Deviation 40411.5126
5th Percentile 1017359.42
95th Percentile 1150913.08
( 95th Percentile - 5th Percentile ) 133553.66
Mean Distribution
Standard Deviation 441.0045
95.00% Confidence Intervall ( 1080536.76 - 1082265.47 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5365
0.1 Scale Factor Error with Delta=300 13940999
0.05 Scale Factor Error with Delta=300 55763995
0.01 Scale Factor Error with Delta=300 1394099854
Priority Target DPS
Sample Data edi_cl Priority Target Damage Per Second
Count 8397
Mean 1081401.12
Minimum 959878.35
Maximum 1250506.61
Spread ( max - min ) 290628.26
Range [ ( max - min ) / 2 * 100% ] 13.44%
Standard Deviation 40411.5126
5th Percentile 1017359.42
95th Percentile 1150913.08
( 95th Percentile - 5th Percentile ) 133553.66
Mean Distribution
Standard Deviation 441.0045
95.00% Confidence Intervall ( 1080536.76 - 1082265.47 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5365
0.1 Scale Factor Error with Delta=300 13940999
0.05 Scale Factor Error with Delta=300 55763995
0.01 Scale Factor Error with Delta=300 1394099854
DPS(e)
Sample Data edi_cl Damage Per Second (Effective)
Count 8397
Mean 1081401.12
Minimum 959878.35
Maximum 1250506.61
Spread ( max - min ) 290628.26
Range [ ( max - min ) / 2 * 100% ] 13.44%
Damage
Sample Data edi_cl Damage
Count 8397
Mean 290622652.00
Minimum 209451525.69
Maximum 387686480.44
Spread ( max - min ) 178234954.74
Range [ ( max - min ) / 2 * 100% ] 30.66%
DTPS
Sample Data edi_cl Damage Taken Per Second
Count 8397
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data edi_cl Healing Per Second
Count 8397
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data edi_cl Healing Per Second (Effective)
Count 8397
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data edi_cl Heal
Count 8397
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data edi_cl Healing Taken Per Second
Count 8397
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data edi_cl Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data edi_clTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data edi_cl Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.98 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.18 totem_mastery,if=buff.resonance_totem.remains<2
9 3.32 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.93 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.38 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.24 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.79 elemental_blast
Keep your EB always on Cooldown.
I 12.01 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.33 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.57 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.51 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 58.13 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.41 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.64 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.08 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 1.98 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.18 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 72.20 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNMLLLMGNMOHRRIRSMRRRSISHMSSSSKGGMMGNOSSHSSPMMSSSMHISSSJMLLLIKMMNHNNNSMFMMSSMHSMISMMRRRSISHKMM97MGMFNNNHQMRRRIMSSSMAJHSISMKNNSMMFHMNNMSMSSIMHMRRRSIMOKNSHNSMMNMNRRRMHSISJMMSSOSSHMIKNSMNNRNHRM9RRRSMISHSSQOSMSSKMGNHMNNSSMAPSJSHMLLORSSMIKHNNMNSSNMSMMHRRPMMORRRSHKGMGNMNSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.945 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.011 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.077 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.141 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.942 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:07.741 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.557 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:09.373 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:10.188 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:11.004 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:11.820 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:12.638 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:13.454 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.541 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.358 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.446 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.484 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.521 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.300 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.337 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.376 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.413 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.449 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.485 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.522 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.560 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.377 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.462 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.524 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.590 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.656 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.721 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:33.474 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:34.228 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:34.981 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
0:35.734 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
0:36.490 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
0:37.246 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
0:38.003 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
0:38.759 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:39.511 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:40.265 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:41.021 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:42.003 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:42.985 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:43.969 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:44.950 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:46.197 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:47.859 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:49.106 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:50.766 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:52.428 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:54.089 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.502 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.913 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:57.668 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:58.651 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
0:59.633 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:00.615 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:01.372 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:02.355 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:03.109 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:03.864 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:04.618 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:05.375 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:06.338 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw
1:07.092 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw
1:08.054 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:08.808 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:10.538 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:11.704 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:12.871 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:14.038 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
1:15.621 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
1:16.810 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.821 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.167 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:19.921 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:20.857 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:21.839 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:22.593 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:23.577 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:24.513 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:25.448 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:26.203 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:27.139 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:27.894 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:28.831 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:29.767 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:30.704 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:31.639 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:33.224 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:34.412 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:36.073 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:37.734 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:39.394 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:40.740 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:41.750 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:43.012 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:43.012 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
1:44.023 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
1:45.015 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
1:46.335 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
1:47.327 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
1:48.316 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:49.072 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:49.826 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:50.790 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:51.543 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:52.507 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:53.470 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:54.431 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:55.393 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:56.146 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:56.901 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:57.883 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:58.865 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:59.849 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:01.509 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:01.509 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:02.757 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:04.445 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:05.634 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:06.823 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:08.010 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.358 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.737 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:11.749 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:12.760 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:13.772 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:14.782 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:15.793 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:16.853 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:18.266 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:19.678 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:20.737 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:21.796 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.857 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.269 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.681 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.094 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.506 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.564 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.621 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:32.032 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:33.352 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:34.672 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:35.993 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:37.314 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:38.660 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:39.414 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:40.351 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:41.105 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:42.042 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
2:42.798 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
2:43.781 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
2:45.009 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact
2:45.761 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact
2:46.742 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact
2:47.497 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact
2:48.478 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact
2:49.232 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact
2:49.986 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact
2:50.743 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:52.402 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:54.063 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:55.724 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:57.385 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:59.045 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.458 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.469 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:02.816 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.827 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.174 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.185 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.196 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.208 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.217 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.227 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.639 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.050 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.461 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.521 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.905 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:17.944 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:19.326 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:20.708 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:21.768 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:22.827 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:24.239 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:25.299 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.712 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.123 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.532 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.592 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.004 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.415 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.826 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:35.808 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:36.790 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:37.544 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:38.529 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:39.690 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:40.629 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:41.565 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:42.320 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:43.074 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:44.010 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:44.947 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:45.884 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:46.821 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:48.452 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due, mark_of_the_claw
3:49.618 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due, mark_of_the_claw
3:50.785 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, mark_of_the_claw
3:52.006 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, mark_of_the_claw
3:53.632 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due
3:55.290 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:56.349 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:57.409 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.821 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.233 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.644 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.644 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.704 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.115 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.174 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.233 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.645 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.057 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.116 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.175 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.235 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.645 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.058 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.469 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.880 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.938 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.349 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:21.759 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:22.818 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:23.829 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:25.174 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:26.186 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
4:27.505 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
4:28.823 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
4:29.813 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:30.806 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:32.124 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.445 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:34.485 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:35.867 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:37.251 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:38.663 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:39.721 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:40.780 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:42.192 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.252 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.664 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:46.076 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.488 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.900 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.312 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.689 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:52.701 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:54.045 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:55.056 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:56.067 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
4:57.386 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
4:58.378 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:59.697 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Spell Speed 39.30% 18.38% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="edi_cl"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:5:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

fs_fs : 1089506 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1089506.5 1089506.5 870.9 / 0.080% 160380.6 / 14.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
fs_fs 1089506
Earth Shock 103973 9.6% 16.4 17.58sec 1901815 1964378 Direct 16.4 1342449 3716707 1901802 23.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.40 16.40 0.00 0.00 0.9682 0.0000 31186457.50 31186457.50 0.00 1964377.52 1964377.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.53 76.44% 1342449.06 1135077 1569506 1342860.52 1231859 1467441 16827127 16827127 0.00
crit 3.86 23.56% 3716707.10 3141892 4344393 3667674.86 0 4344393 14359331 14359331 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60181 (92136) 5.5% (8.5%) 22.1 13.77sec 1250779 943622 Direct 22.0 582388 1611875 819104 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.03 0.00 0.00 1.3255 0.0000 18043286.23 18043286.23 0.00 943622.06 943622.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.96 77.00% 582388.17 521261 640038 582560.32 548345 612431 9878587 9878587 0.00
crit 5.07 23.00% 1611874.74 1442850 1771626 1604398.57 0 1771626 8164699 8164699 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 31955 2.9% 13.9 21.25sec 686736 0 Direct 13.9 489170 1355039 688451 23.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.95 13.91 0.00 0.00 0.0000 0.0000 9577475.17 9577475.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.71 76.99% 489170.26 437859 537632 489302.17 457435 526435 5239231 5239231 0.00
crit 3.20 23.01% 1355039.27 1211994 1488166 1309070.31 0 1488166 4338244 4338244 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 128350 11.8% 11.2 27.79sec 3422338 3566688 Direct 11.2 91666 257789 215081 74.3%  
Periodic 236.3 50467 192651 152242 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.30 236.30 0.9595 1.2619 38388259.45 38388259.45 0.00 124250.74 3566687.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.88 25.71% 91665.81 82554 101365 90689.54 0 101365 264336 264336 0.00
crit 8.33 74.29% 257788.52 228511 280580 257838.63 244672 272995 2148202 2148202 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.2 28.42% 50466.82 35 55752 50461.01 46440 53251 3389166 3389166 0.00
crit 169.1 71.58% 192651.29 100 216050 192758.19 181923 202632 32586555 32586555 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 118286 10.9% 38.3 7.55sec 924957 968349 Direct 38.3 652467 1807156 924936 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.33 38.33 0.00 0.00 0.9552 0.0000 35449322.29 35449322.29 0.00 968349.06 968349.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.28 76.40% 652467.17 505484 724039 652745.09 621852 687142 19104966 19104966 0.00
crit 9.04 23.60% 1807156.36 1632219 2004141 1806707.19 1632219 2004141 16344356 16344356 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 33778 (51911) 3.1% (4.8%) 9.7 32.15sec 1605276 1261533 Direct 9.7 740188 2051684 1046940 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2726 0.0000 10122646.97 10122646.97 0.00 1261532.56 1261532.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.41 76.61% 740188.31 663371 814530 740370.23 687097 798218 5482166 5482166 0.00
crit 2.26 23.39% 2051683.60 1836210 2254619 1885584.88 0 2254619 4640481 4640481 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18133 1.7% 6.2 47.17sec 875611 0 Direct 6.2 622070 1723894 877633 23.2%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.21 6.19 0.00 0.00 0.0000 0.0000 5435834.06 5435834.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.76 76.81% 622069.80 557231 684205 621079.46 0 684205 2959701 2959701 0.00
crit 1.44 23.19% 1723894.38 1542417 1893880 1353415.10 0 1893880 2476133 2476133 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 149867 (235000) 13.8% (21.6%) 59.1 5.03sec 1192415 1022163 Direct 58.9 0 762537 762537 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.08 58.92 0.00 0.00 1.1666 0.0000 44930949.36 44930949.36 0.00 1022163.07 1022163.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.92 100.00% 762537.47 692614 850437 762648.06 740494 791593 44930949 44930949 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77030 7.1% 37.6 7.88sec 614071 0 Direct 37.5 0 616031 616031 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.60 37.48 0.00 0.00 0.0000 0.0000 23087894.83 23087894.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.48 100.00% 616030.60 559584 687093 616136.11 591901 642308 23087895 23087895 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8103 0.7% 43.8 6.18sec 55458 0 Direct 43.8 44705 91183 55459 23.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.81 43.81 0.00 0.00 0.0000 0.0000 2429656.75 2429656.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.67 76.86% 44704.84 42943 47934 44717.11 43199 47458 1505426 1505426 0.00
crit 10.14 23.14% 91183.41 87603 97785 91171.71 0 97785 924231 924231 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103119 (188924) 9.5% (17.4%) 96.2 3.03sec 588502 489920 Direct 96.2 227336 631141 321198 23.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.21 96.21 0.00 0.00 1.2012 0.0000 30902272.74 30902272.74 0.00 489920.37 489920.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.85 76.76% 227336.39 154272 568274 227579.83 190390 263880 16789184 16789184 0.00
crit 22.36 23.24% 631141.15 427024 1572984 631515.46 455089 1050084 14113089 14113089 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 85805 7.9% 93.7 3.80sec 274537 0 Direct 93.7 194044 539736 274526 23.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.68 93.68 0.00 0.00 0.0000 0.0000 25718314.62 25718314.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.87 76.72% 194043.95 129588 477350 194119.79 158987 249105 13945225 13945225 0.00
crit 21.81 23.28% 539735.83 358700 1321306 539904.37 383673 865160 11773090 11773090 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59569) 0.0% (5.4%) 3.0 120.38sec 5941961 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.84 0.00 0.0000 1.0000 0.00 0.00 0.00 306663.47 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19043 1.7% 37.6 6.95sec 150776 0 Direct 37.5 121869 248614 151337 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.61 37.47 0.00 0.00 0.0000 0.0000 5670033.55 5670033.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.76 76.75% 121869.49 121869 121869 121869.49 121869 121869 3504713 3504713 0.00
crit 8.71 23.25% 248613.77 248614 248614 248497.07 0 248614 2165320 2165320 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40526 3.7% 98.8 2.61sec 122168 0 Direct 98.5 98655 201256 122458 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.78 98.55 0.00 0.00 0.0000 0.0000 12067994.72 12067994.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.69 76.80% 98654.92 98655 98655 98654.92 98655 98655 7466784 7466784 0.00
crit 22.86 23.20% 201256.04 201256 201256 201256.04 201256 201256 4601211 4601211 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 136767 / 84778
Fire Blast 136767 7.8% 98.0 2.95sec 258062 139192 Direct 98.0 209443 418888 258060 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.01 98.01 0.00 0.00 1.8540 0.0000 25293888.57 25293888.57 0.00 139192.32 139192.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.26 76.79% 209443.08 199011 222144 209486.85 204636 216235 15763026 15763026 0.00
crit 22.75 23.21% 418887.64 398022 444288 418976.05 405913 438018 9530862 9530862 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186555 / 26579
Lightning Blast 186555 2.4% 42.1 6.71sec 189176 202411 Direct 42.1 153576 307182 189179 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.06 42.06 0.00 0.00 0.9346 0.0000 7956560.42 7956560.42 0.00 202410.65 202410.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.31 76.82% 153576.22 147415 164551 153610.13 149110 161432 4962075 4962075 0.00
crit 9.75 23.18% 307182.15 294831 329102 307258.26 294831 329102 2994486 2994486 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
fs_fs
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.98sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0236 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.59sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 0.00 0.00 0.8219 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.89sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.19 0.00 0.00 0.00 0.5209 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 24.9sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.3sec 69.3sec 8.68% 8.68% 0.0(0.0) 3.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.68%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.0sec 23.5sec 35.08% 35.08% 1.4(1.4) 10.3

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:35.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.93% 34.93% 1.4(1.4) 10.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.7 28.1sec 23.6sec 33.57% 33.57% 1.7(1.7) 9.8

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.9 26.6 4.2sec 3.0sec 59.28% 61.28% 26.6(32.6) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.66%
  • elemental_focus_2:33.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.63% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.40%
  • icefury_2:5.93%
  • icefury_3:5.04%
  • icefury_4:3.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 13.0sec 12.2sec 10.42% 39.77% 1.4(1.4) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.42%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.0 4.2 23.0sec 17.1sec 29.95% 29.95% 4.2(4.2) 12.7

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.6sec 69.6sec 13.50% 13.50% 0.0(0.0) 3.3

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.50%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.0sec 0.0sec 39.91% 39.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.7sec 30.3sec 21.79% 24.12% 1.4(2.9) 0.1

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.16%
  • power_of_the_maelstrom_2:6.30%
  • power_of_the_maelstrom_3:9.33%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.46% 8.93% 0.0(0.0) 0.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.26%
  • stormkeeper_2:3.68%
  • stormkeeper_3:4.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 76.9sec
Lava Surge: During Lava Burst 3.7 58.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6880.0015.3962.4950.0009.382
Fire Elemental0.4960.0011.6510.5510.0003.392
Lava Burst0.9120.0019.6997.5320.00026.460
Elemental Blast0.5400.0014.6349.0192.74918.557
Icefury1.0220.0017.7837.4640.64423.417

Resources

Resource Usage Type Count Total Average RPE APR
fs_fs
earth_shock Maelstrom 133.6 16027.0 120.0 977.4 1945.9
flame_shock Maelstrom 91.4 1630.8 17.8 145.4 23540.1
frost_shock Maelstrom 312.2 6244.9 20.0 162.9 5676.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 481.30 5712.87 (23.47%) 11.87 62.77 1.09%
Lava Burst Overload Maelstrom 306.30 2656.84 (10.91%) 8.67 99.82 3.62%
Lightning Bolt Maelstrom 783.87 6254.54 (25.69%) 7.98 16.38 0.26%
Lightning Bolt Overload Maelstrom 763.22 4527.45 (18.60%) 5.93 51.86 1.13%
Icefury Maelstrom 78.96 1883.52 (7.74%) 23.85 11.64 0.61%
Icefury Overload Maelstrom 50.58 900.27 (3.70%) 17.80 10.18 1.12%
Resonance Totem Maelstrom 2431.60 2408.33 (9.89%) 0.99 23.27 0.96%
Resource RPS-Gain RPS-Loss
Maelstrom 9.96 9.78
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 52.55 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data fs_fs Fight Length
Count 8522
Mean 300.00
Minimum 239.97
Maximum 360.01
Spread ( max - min ) 120.04
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.7797
5th Percentile 245.86
95th Percentile 354.11
( 95th Percentile - 5th Percentile ) 108.24
Mean Distribution
Standard Deviation 0.3876
95.00% Confidence Intervall ( 299.24 - 300.76 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 547
0.1% Error 54643
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 44
0.01 Scale Factor Error with Delta=300 1093
DPS
Sample Data fs_fs Damage Per Second
Count 8522
Mean 1089506.49
Minimum 942498.89
Maximum 1255379.05
Spread ( max - min ) 312880.16
Range [ ( max - min ) / 2 * 100% ] 14.36%
Standard Deviation 41019.6783
5th Percentile 1025392.42
95th Percentile 1159742.73
( 95th Percentile - 5th Percentile ) 134350.31
Mean Distribution
Standard Deviation 444.3462
95.00% Confidence Intervall ( 1088635.59 - 1090377.40 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5446
0.1 Scale Factor Error with Delta=300 14363761
0.05 Scale Factor Error with Delta=300 57455044
0.01 Scale Factor Error with Delta=300 1436376096
Priority Target DPS
Sample Data fs_fs Priority Target Damage Per Second
Count 8522
Mean 1089506.49
Minimum 942498.89
Maximum 1255379.05
Spread ( max - min ) 312880.16
Range [ ( max - min ) / 2 * 100% ] 14.36%
Standard Deviation 41019.6783
5th Percentile 1025392.42
95th Percentile 1159742.73
( 95th Percentile - 5th Percentile ) 134350.31
Mean Distribution
Standard Deviation 444.3462
95.00% Confidence Intervall ( 1088635.59 - 1090377.40 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5446
0.1 Scale Factor Error with Delta=300 14363761
0.05 Scale Factor Error with Delta=300 57455044
0.01 Scale Factor Error with Delta=300 1436376096
DPS(e)
Sample Data fs_fs Damage Per Second (Effective)
Count 8522
Mean 1089506.49
Minimum 942498.89
Maximum 1255379.05
Spread ( max - min ) 312880.16
Range [ ( max - min ) / 2 * 100% ] 14.36%
Damage
Sample Data fs_fs Damage
Count 8522
Mean 293010398.24
Minimum 213408847.65
Maximum 375293989.11
Spread ( max - min ) 161885141.46
Range [ ( max - min ) / 2 * 100% ] 27.62%
DTPS
Sample Data fs_fs Damage Taken Per Second
Count 8522
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data fs_fs Healing Per Second
Count 8522
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data fs_fs Healing Per Second (Effective)
Count 8522
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data fs_fs Heal
Count 8522
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data fs_fs Healing Taken Per Second
Count 8522
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data fs_fs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data fs_fsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data fs_fs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.17 totem_mastery,if=buff.resonance_totem.remains<2
9 3.37 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.98 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.47 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.46 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.11 elemental_blast
Keep your EB always on Cooldown.
I 12.19 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.40 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.70 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.60 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 59.05 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.75 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.71 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.16 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.02 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.58 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 73.09 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNSMLLMNMRHFMRIRRMSSSSPSHMMRRKGNNNMROSHMSMIMMSSSSHMIJMSSSKMGNHMNMNFSSSSIHMSSSMSS97PHKMMNNNFMNMQHRRRMSOSAJPSHMSSSKMGNNNSHMMMPSSMOMSSHSSMISSKNMNHNSNSMSSOSSHJMSPSSMSSSHKGGMGN9RMIHRRSMSMSFMMIMSQHSMSKGNMNMHNMOMMAPRJLLMHLMIMRRMRKGGHMGNOSSMISSHMSMSSSIMMSHKNNMN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.963 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.049 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:05.135 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:06.221 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:07.021 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:07.820 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
0:08.620 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:09.420 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, lava_surge, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:10.220 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:11.018 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:11.818 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:12.617 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:13.435 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.521 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.607 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.694 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.473 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.250 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.285 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.065 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.102 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.139 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.175 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.212 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.248 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.285 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.322 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.139 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.227 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.315 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.131 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.217 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.305 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.391 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.478 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:36.295 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:37.110 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:37.925 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:38.740 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.828 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.893 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.692 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.075 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.459 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.452 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.797 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.806 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.817 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.827 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.174 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.519 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.866 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.213 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.625 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.037 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.096 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.156 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.215 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.626 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:03.665 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.703 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.742 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.124 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
1:08.506 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:09.566 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:10.626 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:12.037 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:13.047 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:14.057 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:15.404 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:16.416 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.428 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.774 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.120 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.465 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.813 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.871 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.443 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.856 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.266 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.679 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.091 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.503 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.916 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:35.301 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:36.340 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:36.340 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:37.378 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:38.824 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:40.207 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
1:41.266 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
1:42.677 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
1:43.737 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
1:44.796 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
1:45.856 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
1:46.914 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
1:47.974 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
1:49.033 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:50.444 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.198 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.609 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:53.993 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:55.375 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.757 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.141 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.524 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.584 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.993 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.993 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.054 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.115 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.173 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.584 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.930 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.940 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.950 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.296 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.644 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:13.990 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
2:14.982 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
2:15.971 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
2:16.963 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
2:18.001 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:19.386 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:20.771 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.780 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.127 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:24.120 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:25.111 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:26.431 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:27.752 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:28.743 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:29.735 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:31.057 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:32.440 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:33.851 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:35.262 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:36.608 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.954 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.301 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.310 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.659 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.006 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.353 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:45.363 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:46.775 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:47.834 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:49.246 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:50.305 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:51.651 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:52.662 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.007 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.352 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.699 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.046 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.057 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.405 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.816 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.227 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.237 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.583 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.592 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.602 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.613 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.625 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.971 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.317 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.664 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.077 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:16.605 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:17.988 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
3:19.028 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
3:20.067 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:21.451 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:22.509 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:23.569 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.630 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.042 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.452 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.512 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.014 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:30.952 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:31.889 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:32.825 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:33.758 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:34.695 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:35.450 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:36.387 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:37.140 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:37.894 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:38.832 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:39.589 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:40.343 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:41.324 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:42.079 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:43.742 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:45.326 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:46.908 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:48.493 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:50.076 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:51.087 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:52.097 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:53.108 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:54.117 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:55.528 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:57.118 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:58.156 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:59.195 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.235 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.274 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.658 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.658 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:03.696 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.107 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.166 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.224 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.282 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.344 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.756 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.815 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.226 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:14.264 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:15.303 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.686 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:18.069 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.454 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.866 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.278 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:23.338 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:24.398 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:25.809 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:27.222 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:28.280 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:29.340 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.400 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.815 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.227 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.639 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.698 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.110 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.522 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.935 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.995 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.407 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.819 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.229 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.641 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.055 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.115 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.172 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.583 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.994 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.405 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.817 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
4:56.877 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
4:57.938 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
4:59.348 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="fs_fs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:5:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

li_lvb : 1087789 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1087789.1 1087789.1 869.4 / 0.080% 158566.7 / 14.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
li_lvb 1087789
Earth Shock 103848 9.6% 16.4 17.61sec 1901129 1963314 Direct 16.4 1343260 3718692 1901139 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.38 16.38 0.00 0.00 0.9683 0.0000 31138158.78 31138158.78 0.00 1963313.92 1963313.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.53 76.51% 1343259.92 1135077 1569506 1343710.35 1251380 1467741 16834041 16834041 0.00
crit 3.85 23.49% 3718692.20 3141892 4344393 3674440.44 0 4344393 14304117 14304117 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60277 (92166) 5.5% (8.5%) 22.1 13.76sec 1251280 944103 Direct 22.0 582421 1611781 820368 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.03 0.00 0.00 1.3254 0.0000 18073209.11 18073209.11 0.00 944102.91 944102.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.94 76.89% 582421.28 521261 640038 582576.45 554276 611542 9865312 9865312 0.00
crit 5.09 23.11% 1611781.36 1442850 1771626 1605428.32 0 1771626 8207897 8207897 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 31890 2.9% 14.0 21.23sec 684907 0 Direct 13.9 489163 1354322 686450 22.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.96 13.93 0.00 0.00 0.0000 0.0000 9564459.36 9564459.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.76 77.20% 489162.64 437859 537632 489341.50 450532 523482 5261416 5261416 0.00
crit 3.18 22.80% 1354322.14 1211994 1488166 1310704.68 0 1488166 4303044 4303044 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 121006 11.1% 11.2 27.77sec 3227233 3363837 Direct 11.2 86424 243026 202677 74.2%  
Periodic 236.3 47587 181666 143551 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 236.26 236.26 0.9594 1.2621 36188157.71 36188157.71 0.00 117136.90 3363836.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.89 25.77% 86423.60 77837 95573 85549.89 0 95573 249701 249701 0.00
crit 8.32 74.23% 243025.51 215453 264547 243070.82 230487 257396 2023006 2023006 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.2 28.43% 47587.19 100 52566 47580.75 43757 50022 3195925 3195925 0.00
crit 169.1 71.57% 181665.51 277 203705 181763.58 171549 190764 30719526 30719526 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 118222 10.9% 38.3 7.55sec 924415 967136 Direct 38.3 652410 1807018 924426 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.33 38.33 0.00 0.00 0.9558 0.0000 35435853.19 35435853.19 0.00 967135.73 967135.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.30 76.44% 652409.77 525172 724039 652727.24 623260 689251 19117614 19117614 0.00
crit 9.03 23.56% 1807018.38 1577301 2004141 1806265.69 0 2004141 16318240 16318240 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 33749 (51917) 3.1% (4.8%) 9.7 32.15sec 1605070 1260556 Direct 9.7 740520 2050768 1045853 23.3%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2734 0.0000 10111479.92 10111479.92 0.00 1260556.10 1260556.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.41 76.69% 740520.46 663371 814530 740728.93 678200 814530 5490807 5490807 0.00
crit 2.25 23.31% 2050768.41 1836210 2254619 1885698.22 0 2254619 4620673 4620673 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18169 1.7% 6.2 47.05sec 881396 0 Direct 6.2 622173 1722404 883011 23.7%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.18 6.17 0.00 0.00 0.0000 0.0000 5445042.96 5445042.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.70 76.28% 622173.26 557231 684205 620928.96 0 684205 2926030 2926030 0.00
crit 1.46 23.72% 1722403.71 1542417 1893880 1364572.97 0 1893880 2519013 2519013 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 153558 (240598) 14.1% (22.1%) 59.0 5.04sec 1223469 1047907 Direct 58.8 0 782800 782800 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.96 58.81 0.00 0.00 1.1675 0.0000 46034086.39 46034086.39 0.00 1047907.30 1047907.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.81 100.00% 782799.61 711167 873216 782917.41 757555 810797 46034086 46034086 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 78927 7.3% 37.5 7.86sec 630629 0 Direct 37.4 0 632444 632444 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.53 37.42 0.00 0.00 0.0000 0.0000 23664618.65 23664618.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.42 100.00% 632444.11 574572 705497 632545.81 608635 660507 23664619 23664619 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8113 0.7% 43.8 6.21sec 55522 0 Direct 43.8 44721 91236 55522 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.80 43.80 0.00 0.00 0.0000 0.0000 2431897.89 2431897.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.63 76.78% 44721.14 42943 47934 44732.59 43056 47934 1504010 1504010 0.00
crit 10.17 23.22% 91236.28 87603 97785 91228.04 0 97785 927888 927888 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103110 (189063) 9.5% (17.4%) 96.2 3.04sec 588756 490127 Direct 96.2 227177 632563 321017 23.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.24 96.24 0.00 0.00 1.2012 0.0000 30893745.58 30893745.58 0.00 490127.03 490127.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.96 76.85% 227176.81 154272 568274 227400.73 192198 263795 16802062 16802062 0.00
crit 22.28 23.15% 632563.47 427024 1572984 632933.01 455354 991955 14091684 14091684 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 85953 7.9% 93.8 3.79sec 274628 0 Direct 93.8 194089 540116 274617 23.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.82 93.82 0.00 0.00 0.0000 0.0000 25765429.40 25765429.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.98 76.73% 194089.19 129588 477350 194172.54 156456 254469 13971705 13971705 0.00
crit 21.84 23.27% 540115.59 358700 1321306 540311.15 383647 915245 11793724 11793724 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59572) 0.0% (5.4%) 3.0 120.37sec 5946390 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.77 0.00 0.0000 1.0000 0.00 0.00 0.00 307001.95 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19065 1.7% 37.7 7.00sec 150637 0 Direct 37.5 121869 248614 151245 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.67 37.51 0.00 0.00 0.0000 0.0000 5673805.47 5673805.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.82 76.82% 121869.49 121869 121869 121869.49 121869 121869 3512206 3512206 0.00
crit 8.69 23.18% 248613.77 248614 248614 248613.77 248614 248614 2161600 2161600 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40506 3.7% 98.8 2.62sec 122108 0 Direct 98.5 98655 201256 122412 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.77 98.52 0.00 0.00 0.0000 0.0000 12060162.44 12060162.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.71 76.84% 98654.92 98655 98655 98654.92 98655 98655 7468934 7468934 0.00
crit 22.81 23.16% 201256.04 201256 201256 201256.04 201256 201256 4591228 4591228 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 136716 / 84792
Fire Blast 136716 7.8% 98.1 2.97sec 258000 139140 Direct 98.1 209436 418857 257995 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.05 98.05 0.00 0.00 1.8543 0.0000 25297663.50 25297663.50 0.00 139139.58 139139.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.31 76.81% 209436.11 199011 222144 209482.55 204549 216628 15773604 15773604 0.00
crit 22.74 23.19% 418857.43 398022 444288 418931.01 405349 439035 9524059 9524059 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186702 / 26605
Lightning Blast 186702 2.4% 42.1 6.72sec 189245 202517 Direct 42.1 153657 307272 189249 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.07 42.07 0.00 0.00 0.9345 0.0000 7962367.11 7962367.11 0.00 202517.16 202517.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.33 76.83% 153657.45 147415 164551 153694.16 148880 161872 4967354 4967354 0.00
crit 9.75 23.17% 307272.22 294831 329102 307361.28 294831 329102 2995013 2995013 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
li_lvb
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.91sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0243 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 0.00 0.00 0.8220 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.88sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5212 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 25.0sec 32.16% 32.16% 3.1(3.1) 8.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.8sec 69.8sec 8.66% 8.66% 0.0(0.0) 3.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.66%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.5 27.2sec 23.6sec 34.78% 34.78% 1.5(1.5) 10.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.87% 34.87% 1.4(1.4) 10.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.9sec 23.4sec 33.84% 33.84% 1.8(1.8) 9.9

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.84%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.8 26.4 4.2sec 3.0sec 59.19% 61.19% 26.4(32.4) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.65%
  • elemental_focus_2:33.54%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.66% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.42%
  • icefury_2:5.97%
  • icefury_3:5.05%
  • icefury_4:3.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.4 13.1sec 12.3sec 10.32% 39.64% 1.4(1.4) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.32%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.89% 29.89% 4.2(4.2) 12.6

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 70.1sec 70.1sec 13.47% 13.47% 0.0(0.0) 3.3

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.47%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.1sec 0.0sec 39.92% 39.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.8sec 30.3sec 21.93% 24.12% 1.4(2.9) 0.1

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.19%
  • power_of_the_maelstrom_2:6.33%
  • power_of_the_maelstrom_3:9.41%

Trigger Attempt Success

  • trigger_pct:15.07%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.47% 8.92% 0.0(0.0) 0.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.26%
  • stormkeeper_2:3.68%
  • stormkeeper_3:4.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.5 12.3sec
Lava Surge: Wasted 1.4 78.1sec
Lava Surge: During Lava Burst 3.7 58.0sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6870.0014.5552.4830.0009.621
Fire Elemental0.4970.0011.6480.5420.0003.327
Lava Burst0.9070.0018.1327.4300.00026.861
Elemental Blast0.5410.0014.5599.0103.06517.764
Icefury1.0270.0018.8857.5090.59723.292

Resources

Resource Usage Type Count Total Average RPE APR
li_lvb
earth_shock Maelstrom 133.8 16053.7 120.0 980.2 1939.6
flame_shock Maelstrom 91.6 1634.8 17.8 145.8 22136.2
frost_shock Maelstrom 313.1 6262.8 20.0 163.4 5658.2
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 481.57 5716.76 (23.44%) 11.87 62.05 1.07%
Lava Burst Overload Maelstrom 306.53 2656.88 (10.89%) 8.67 101.86 3.69%
Lightning Bolt Maelstrom 786.10 6272.56 (25.72%) 7.98 16.28 0.26%
Lightning Bolt Overload Maelstrom 766.36 4543.47 (18.63%) 5.93 54.69 1.19%
Icefury Maelstrom 79.17 1888.69 (7.74%) 23.86 11.47 0.60%
Icefury Overload Maelstrom 50.46 898.08 (3.68%) 17.80 10.28 1.13%
Resonance Totem Maelstrom 2437.84 2414.28 (9.90%) 0.99 23.55 0.97%
Resource RPS-Gain RPS-Loss
Maelstrom 9.95 9.77
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.64 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data li_lvb Fight Length
Count 8422
Mean 299.98
Minimum 239.94
Maximum 360.03
Spread ( max - min ) 120.09
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 36.2737
5th Percentile 245.37
95th Percentile 354.56
( 95th Percentile - 5th Percentile ) 109.19
Mean Distribution
Standard Deviation 0.3953
95.00% Confidence Intervall ( 299.21 - 300.76 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 562
0.1% Error 56168
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1124
DPS
Sample Data li_lvb Damage Per Second
Count 8422
Mean 1087789.09
Minimum 945427.06
Maximum 1265361.99
Spread ( max - min ) 319934.93
Range [ ( max - min ) / 2 * 100% ] 14.71%
Standard Deviation 40709.9395
5th Percentile 1023463.09
95th Percentile 1157247.88
( 95th Percentile - 5th Percentile ) 133784.79
Mean Distribution
Standard Deviation 443.6013
95.00% Confidence Intervall ( 1086919.65 - 1088658.54 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5381
0.1 Scale Factor Error with Delta=300 14147659
0.05 Scale Factor Error with Delta=300 56590636
0.01 Scale Factor Error with Delta=300 1414765898
Priority Target DPS
Sample Data li_lvb Priority Target Damage Per Second
Count 8422
Mean 1087789.09
Minimum 945427.06
Maximum 1265361.99
Spread ( max - min ) 319934.93
Range [ ( max - min ) / 2 * 100% ] 14.71%
Standard Deviation 40709.9395
5th Percentile 1023463.09
95th Percentile 1157247.88
( 95th Percentile - 5th Percentile ) 133784.79
Mean Distribution
Standard Deviation 443.6013
95.00% Confidence Intervall ( 1086919.65 - 1088658.54 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5381
0.1 Scale Factor Error with Delta=300 14147659
0.05 Scale Factor Error with Delta=300 56590636
0.01 Scale Factor Error with Delta=300 1414765898
DPS(e)
Sample Data li_lvb Damage Per Second (Effective)
Count 8422
Mean 1087789.09
Minimum 945427.06
Maximum 1265361.99
Spread ( max - min ) 319934.93
Range [ ( max - min ) / 2 * 100% ] 14.71%
Damage
Sample Data li_lvb Damage
Count 8422
Mean 292480106.85
Minimum 214969814.28
Maximum 372121997.35
Spread ( max - min ) 157152183.07
Range [ ( max - min ) / 2 * 100% ] 26.87%
DTPS
Sample Data li_lvb Damage Taken Per Second
Count 8422
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data li_lvb Healing Per Second
Count 8422
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data li_lvb Healing Per Second (Effective)
Count 8422
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data li_lvb Heal
Count 8422
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data li_lvb Healing Taken Per Second
Count 8422
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data li_lvb Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data li_lvbTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data li_lvb Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.99 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.17 totem_mastery,if=buff.resonance_totem.remains<2
9 3.33 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.94 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.38 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.35 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 21.85 elemental_blast
Keep your EB always on Cooldown.
I 12.06 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.35 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.59 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.58 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 58.24 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.42 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.66 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.08 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.00 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 72.24 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMLLGLGNNMOMSMIHMSMSMSSMISSMHMSSSKGGMGNOSSHSMIMSSSMSSHMISJMSSKNMMGHNNOSSMSSISMSSMHMSPSM97MKNHMMGNNRFMRQRHISMSSSAJMMSHIKMNMMNMFNNHMSSSSMISSHSMSOSKGGMMGGHRRIMMRSSSHJMLILLMSKMGFHMGM9MGMGRPRHMRRROMPQSKHNMNNSSNMSSHSASMJPSSOSSMMRHRRPKNMNNSNHMSSSSSMSMHISMSFMKNNMHMNNMS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.880 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:02.637 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:03.394 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:04.149 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:04.905 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:05.659 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:06.414 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:07.170 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:07.924 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.679 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:09.433 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:10.186 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:10.941 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:11.694 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:12.449 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:13.203 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:14.143 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:15.086 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:16.338 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:17.236 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:18.432 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:19.331 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:20.527 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:21.723 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.741 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.756 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.521 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.298 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.334 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.422 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.238 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.421 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.458 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.493 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.529 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.564 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.602 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:35.381 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:36.160 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:37.177 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:37.941 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:38.706 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:39.471 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:40.536 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:41.601 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.013 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.425 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.772 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.782 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.792 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.139 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.485 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.832 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.178 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.525 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.935 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.349 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.360 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.370 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.715 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.725 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.071 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.081 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.092 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.439 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:07.450 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:08.862 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:09.921 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:10.981 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:12.392 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact
1:13.146 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact
1:13.900 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:14.654 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:15.407 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:16.390 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:17.372 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:18.354 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:19.337 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:20.091 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:21.074 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:21.829 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:22.793 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:23.754 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:24.976 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:26.605 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:28.234 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:29.895 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:31.143 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:32.804 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.216 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.275 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.275 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.334 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.846 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
1:38.906 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
1:40.316 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
1:41.663 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
1:42.674 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
1:43.684 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
1:44.694 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:45.704 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.050 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.061 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.409 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.754 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.507 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.919 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.331 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:55.323 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:56.644 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:57.964 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:59.283 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:00.603 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.949 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.949 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.959 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.969 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.316 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.375 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.786 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.797 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.145 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:11.154 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
2:12.164 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:13.510 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:14.521 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
2:15.531 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:16.542 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:17.552 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
2:18.562 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
2:19.619 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.193 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.605 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.951 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.295 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.643 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.989 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.335 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.345 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.690 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:33.103 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:34.601 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:36.012 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.332 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.654 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:39.646 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:40.968 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:42.287 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:43.296 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:44.306 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:45.316 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:46.727 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:47.787 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:48.848 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.259 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.669 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.054 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.092 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.131 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.514 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.898 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.282 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.667 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.052 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.637 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.676 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.735 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.794 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.854 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.914 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.973 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.385 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.796 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.207 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:15.619 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
3:16.658 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
3:17.697 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
3:19.082 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
3:20.120 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
3:21.157 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:22.217 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:23.279 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:24.338 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:25.396 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:26.808 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:27.867 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.278 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.337 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.747 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:33.131 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:34.513 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:35.895 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:37.278 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:38.689 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.748 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.160 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.219 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.974 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.386 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.798 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:47.208 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:48.268 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:49.680 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:50.740 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:51.798 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:53.211 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:54.622 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:55.680 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.092 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.503 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.914 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.326 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.737 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.737 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.147 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:05.129 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:05.882 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:06.636 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:07.389 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:08.144 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:08.898 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:09.653 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:10.614 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:11.369 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:12.332 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:13.295 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:14.283 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:15.203 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:16.121 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:16.874 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:18.459 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due
4:19.646 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due
4:21.229 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due
4:22.417 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due
4:23.606 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due
4:25.189 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:26.248 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.690 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.101 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.511 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.925 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:33.337 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.749 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.159 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:37.569 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.980 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.040 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.450 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.461 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.808 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.156 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.502 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.513 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.524 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:49.845 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:50.838 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:51.831 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:53.214 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:54.833 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:55.891 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:56.951 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:58.009 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.068 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="li_lvb"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:5:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

mb_lvs : 1086667 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1086667.1 1086667.1 868.6 / 0.080% 159547.7 / 14.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
mb_lvs 1086667
Earth Shock 103911 9.6% 16.4 17.60sec 1902495 1965014 Direct 16.4 1342659 3717349 1902474 23.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.38 16.38 0.00 0.00 0.9682 0.0000 31171014.89 31171014.89 0.00 1965013.86 1965013.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.52 76.43% 1342659.22 1135077 1569506 1343246.52 1240659 1448542 16812431 16812431 0.00
crit 3.86 23.57% 3717349.28 3141892 4344393 3662246.01 0 4344393 14358584 14358584 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60340 (92209) 5.6% (8.5%) 22.1 13.76sec 1251889 944245 Direct 22.0 582426 1611840 821113 23.2%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.03 0.00 0.00 1.3258 0.0000 18088108.50 18088108.50 0.00 944245.18 944245.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.92 76.81% 582425.61 521261 640038 582581.79 553453 610247 9855129 9855129 0.00
crit 5.11 23.19% 1611840.47 1442850 1771626 1606169.80 0 1771626 8232980 8232980 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 31868 2.9% 14.0 21.01sec 684444 0 Direct 13.9 489231 1354338 685986 22.7%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.96 13.93 0.00 0.00 0.0000 0.0000 9553724.99 9553724.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.76 77.26% 489231.46 437859 537632 489313.27 437859 524712 5264204 5264204 0.00
crit 3.17 22.74% 1354337.53 1211994 1488166 1306696.97 0 1488166 4289521 4289521 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120963 11.1% 11.2 27.79sec 3225377 3361686 Direct 11.2 86434 243069 202665 74.2%  
Periodic 236.2 47579 181667 143523 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.23 236.23 0.9595 1.2623 36178464.88 36178464.88 0.00 117099.46 3361686.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.89 25.80% 86433.73 77837 95573 85537.02 0 95573 250104 250104 0.00
crit 8.32 74.20% 243069.26 215453 264547 243106.43 228626 256204 2023126 2023126 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.2 28.45% 47579.32 61 52566 47571.84 43756 49845 3197158 3197158 0.00
crit 169.0 71.55% 181666.58 120 203705 181763.94 171296 190804 30708077 30708077 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 118230 10.9% 38.3 7.55sec 924564 966875 Direct 38.3 652446 1807045 924571 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.33 38.33 0.00 0.00 0.9563 0.0000 35434985.70 35434985.70 0.00 966874.56 966874.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.29 76.43% 652446.23 539032 724039 652750.78 624571 689999 19112638 19112638 0.00
crit 9.03 23.57% 1807045.05 1632219 2004141 1806716.59 0 2004141 16322348 16322348 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 33795 (51925) 3.1% (4.8%) 9.7 32.15sec 1605270 1260770 Direct 9.7 740452 2052186 1047434 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2733 0.0000 10128880.69 10128880.69 0.00 1260769.80 1260769.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.41 76.60% 740452.15 663371 814530 740624.88 678793 798218 5484412 5484412 0.00
crit 2.26 23.40% 2052186.43 1836210 2254619 1900144.86 0 2254619 4644469 4644469 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18130 1.7% 6.2 46.39sec 877958 0 Direct 6.2 622260 1723978 879909 23.4%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.19 6.17 0.00 0.00 0.0000 0.0000 5430279.35 5430279.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.73 76.61% 622260.33 557231 684205 621392.66 0 684205 2942215 2942215 0.00
crit 1.44 23.39% 1723978.35 1542417 1893880 1362997.55 0 1893880 2488064 2488064 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 153310 (239449) 14.1% (22.1%) 59.1 5.03sec 1215430 1041345 Direct 58.9 0 780105 780105 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.07 58.92 0.00 0.00 1.1672 0.0000 45965104.99 45965104.99 0.00 1041344.85 1041344.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.92 100.00% 780105.30 708669 870150 780236.26 755062 807003 45965105 45965105 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 78024 7.2% 37.6 7.89sec 622828 0 Direct 37.4 0 624673 624673 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.56 37.45 0.00 0.00 0.0000 0.0000 23393674.12 23393674.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.45 100.00% 624672.85 567517 696834 624769.36 601948 653814 23393674 23393674 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8116 0.7% 43.9 6.14sec 55444 0 Direct 43.9 44714 91211 55443 23.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.89 43.89 0.00 0.00 0.0000 0.0000 2433617.54 2433617.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.76 76.92% 44713.56 42943 47934 44725.54 43135 47400 1509689 1509689 0.00
crit 10.13 23.08% 91210.84 87603 97785 91214.85 0 97785 923929 923929 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103088 (188949) 9.5% (17.4%) 96.1 3.04sec 589122 490400 Direct 96.1 227343 632423 321368 23.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.13 96.13 0.00 0.00 1.2013 0.0000 30892744.72 30892744.72 0.00 490400.30 490400.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.82 76.79% 227343.23 154272 568274 227623.97 193164 264582 16782859 16782859 0.00
crit 22.31 23.21% 632423.26 427024 1572984 632790.31 458195 940929 14109886 14109886 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 85862 7.9% 93.6 3.79sec 274901 0 Direct 93.6 194197 539886 274886 23.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.63 93.63 0.00 0.00 0.0000 0.0000 25739662.85 25739662.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.77 76.66% 194196.64 129588 477350 194263.09 156618 253884 13938353 13938353 0.00
crit 21.86 23.34% 539885.93 358700 1321306 540058.70 381991 874996 11801310 11801310 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59716) 0.0% (5.5%) 3.0 120.39sec 5958187 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.90 0.00 0.0000 1.0000 0.00 0.00 0.00 307013.67 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19091 1.7% 37.7 6.94sec 150631 0 Direct 37.6 121869 248614 151187 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.72 37.58 0.00 0.00 0.0000 0.0000 5682228.79 5682228.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.89 76.87% 121869.49 121869 121869 121869.49 121869 121869 3520676 3520676 0.00
crit 8.69 23.13% 248613.77 248614 248614 248613.77 248614 248614 2161553 2161553 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40625 3.7% 99.0 2.61sec 122224 0 Direct 98.7 98655 201256 122519 23.3%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.96 98.72 0.00 0.00 0.0000 0.0000 12094783.79 12094783.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.76 76.74% 98654.92 98655 98655 98654.92 98655 98655 7473638 7473638 0.00
crit 22.96 23.26% 201256.04 201256 201256 201256.04 201256 201256 4621146 4621146 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 136638 / 84698
Fire Blast 136638 7.8% 98.0 2.95sec 257893 139052 Direct 98.0 209439 418884 257901 23.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.99 97.99 0.00 0.00 1.8547 0.0000 25270969.03 25270969.03 0.00 139052.42 139052.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.32 76.87% 209438.71 199011 222144 209484.30 205074 216587 15775083 15775083 0.00
crit 22.67 23.13% 418884.14 398022 444288 418962.52 405385 435876 9495886 9495886 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186698 / 26616
Lightning Blast 186698 2.4% 42.1 6.71sec 189190 202583 Direct 42.1 153613 307257 189184 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.12 42.12 0.00 0.00 0.9339 0.0000 7968994.76 7968994.76 0.00 202582.68 202582.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.37 76.84% 153613.12 147415 164551 153649.13 148734 161097 4972204 4972204 0.00
crit 9.75 23.16% 307256.81 294831 329102 307349.98 294831 329102 2996791 2996791 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
mb_lvs
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.56sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0228 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.57sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 0.00 0.00 0.8214 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.00sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.19 0.00 0.00 0.00 0.5208 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.18% 32.18% 3.1(3.1) 8.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.7sec 69.7sec 8.63% 8.63% 0.0(0.0) 3.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.63%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.3sec 23.7sec 34.76% 34.76% 1.4(1.4) 10.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.5 1.4 27.2sec 23.7sec 34.77% 34.77% 1.4(1.4) 10.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.9sec 23.4sec 33.97% 33.97% 1.8(1.8) 9.9

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.9 26.5 4.2sec 3.0sec 59.23% 61.27% 26.5(32.5) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.69%
  • elemental_focus_2:33.54%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.64% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.40%
  • icefury_2:5.95%
  • icefury_3:5.04%
  • icefury_4:3.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 13.0sec 12.2sec 10.40% 39.71% 1.4(1.4) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.40%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.0 4.2 23.0sec 17.0sec 29.96% 29.96% 4.2(4.2) 12.7

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 70.1sec 70.1sec 13.42% 13.42% 0.0(0.0) 3.3

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.42%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.1sec 0.0sec 39.90% 39.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.4 1.4 36.8sec 30.3sec 21.82% 24.07% 1.4(2.9) 0.1

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.17%
  • power_of_the_maelstrom_2:6.35%
  • power_of_the_maelstrom_3:9.30%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.47% 8.94% 0.0(0.0) 0.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.25%
  • stormkeeper_2:3.69%
  • stormkeeper_3:4.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 78.2sec
Lava Surge: During Lava Burst 3.7 58.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6880.0014.3102.4880.0009.575
Fire Elemental0.4950.0011.6690.5420.0003.557
Lava Burst0.9100.0018.6507.4270.00025.651
Elemental Blast0.5410.0014.9588.9962.85618.162
Icefury1.0200.0018.1447.4650.82020.508

Resources

Resource Usage Type Count Total Average RPE APR
mb_lvs
earth_shock Maelstrom 133.3 15993.0 120.0 976.1 1949.0
flame_shock Maelstrom 91.3 1628.7 17.8 145.2 22213.7
frost_shock Maelstrom 311.8 6236.5 20.0 162.7 5681.9
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 480.57 5705.94 (23.49%) 11.87 60.85 1.06%
Lava Burst Overload Maelstrom 305.59 2649.40 (10.91%) 8.67 100.88 3.67%
Lightning Bolt Maelstrom 782.13 6240.61 (25.69%) 7.98 16.47 0.26%
Lightning Bolt Overload Maelstrom 761.82 4517.49 (18.59%) 5.93 53.44 1.17%
Icefury Maelstrom 78.86 1880.98 (7.74%) 23.85 11.67 0.62%
Icefury Overload Maelstrom 50.32 895.13 (3.68%) 17.79 10.67 1.18%
Resonance Totem Maelstrom 2428.14 2404.85 (9.90%) 0.99 23.29 0.96%
Resource RPS-Gain RPS-Loss
Maelstrom 9.95 9.77
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 52.47 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data mb_lvs Fight Length
Count 8551
Mean 299.99
Minimum 239.96
Maximum 360.02
Spread ( max - min ) 120.06
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.6184
5th Percentile 246.24
95th Percentile 353.73
( 95th Percentile - 5th Percentile ) 107.49
Mean Distribution
Standard Deviation 0.3852
95.00% Confidence Intervall ( 299.24 - 300.75 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 542
0.1% Error 54154
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 44
0.01 Scale Factor Error with Delta=300 1084
DPS
Sample Data mb_lvs Damage Per Second
Count 8551
Mean 1086667.09
Minimum 961733.20
Maximum 1263177.85
Spread ( max - min ) 301444.65
Range [ ( max - min ) / 2 * 100% ] 13.87%
Standard Deviation 40979.6640
5th Percentile 1021437.76
95th Percentile 1157266.93
( 95th Percentile - 5th Percentile ) 135829.17
Mean Distribution
Standard Deviation 443.1594
95.00% Confidence Intervall ( 1085798.52 - 1087535.67 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5464
0.1 Scale Factor Error with Delta=300 14335752
0.05 Scale Factor Error with Delta=300 57343005
0.01 Scale Factor Error with Delta=300 1433575122
Priority Target DPS
Sample Data mb_lvs Priority Target Damage Per Second
Count 8551
Mean 1086667.09
Minimum 961733.20
Maximum 1263177.85
Spread ( max - min ) 301444.65
Range [ ( max - min ) / 2 * 100% ] 13.87%
Standard Deviation 40979.6640
5th Percentile 1021437.76
95th Percentile 1157266.93
( 95th Percentile - 5th Percentile ) 135829.17
Mean Distribution
Standard Deviation 443.1594
95.00% Confidence Intervall ( 1085798.52 - 1087535.67 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5464
0.1 Scale Factor Error with Delta=300 14335752
0.05 Scale Factor Error with Delta=300 57343005
0.01 Scale Factor Error with Delta=300 1433575122
DPS(e)
Sample Data mb_lvs Damage Per Second (Effective)
Count 8551
Mean 1086667.09
Minimum 961733.20
Maximum 1263177.85
Spread ( max - min ) 301444.65
Range [ ( max - min ) / 2 * 100% ] 13.87%
Damage
Sample Data mb_lvs Damage
Count 8551
Mean 292187275.82
Minimum 206885323.65
Maximum 374380498.31
Spread ( max - min ) 167495174.66
Range [ ( max - min ) / 2 * 100% ] 28.66%
DTPS
Sample Data mb_lvs Damage Taken Per Second
Count 8551
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data mb_lvs Healing Per Second
Count 8551
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data mb_lvs Healing Per Second (Effective)
Count 8551
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data mb_lvs Heal
Count 8551
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data mb_lvs Healing Taken Per Second
Count 8551
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data mb_lvs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data mb_lvsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data mb_lvs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.17 totem_mastery,if=buff.resonance_totem.remains<2
9 3.38 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.98 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.44 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.38 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.19 elemental_blast
Keep your EB always on Cooldown.
I 12.24 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.42 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.73 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.62 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 59.25 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.96 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.78 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.15 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.02 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.58 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 73.32 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNMNNSNSOSMSHMRMIMRRSMSPMMHSSSSKGMGMGNORHRMIRSSSMSSHMIJMSSMSSKGGMGMHGOSMSISSSHMSM97SMPSSKHMNNNSFSMNQSHSSMSSAJSISMHOKNNMMNNSSSHMSSSIMRRRHSMOSSIKMNNHRMNMMMNRRMMHIJLSSSMRORKGGHM9GMGRMIMRHRRMOSSQSIMHKNNSSMNNSSSSSHMAMIRJLLMSOHSSMIKNNSMMNHNSSMSSMMISOSHMSSSSMSSIHKNMM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.943 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.008 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.074 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.138 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.938 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.737 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:08.536 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:09.335 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.151 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.968 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.785 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.601 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.417 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.504 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.591 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.676 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.494 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.580 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.397 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.213 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.300 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.386 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.473 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.559 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.376 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.463 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.280 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.098 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.185 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.273 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.359 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.445 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.531 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.619 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.706 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:36.524 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:37.341 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:38.158 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:39.244 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:40.061 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:40.879 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:41.695 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.106 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:44.516 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.928 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.272 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.284 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:49.604 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:50.924 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:52.245 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:53.567 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:54.889 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.210 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:57.592 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.974 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
0:59.729 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:00.484 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:01.240 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:02.202 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:02.955 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:03.709 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
1:04.463 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:05.217 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:06.199 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:07.183 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
1:07.938 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
1:08.694 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
1:09.448 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, mark_of_the_claw
1:10.203 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw
1:11.166 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due, mark_of_the_claw
1:12.793 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due, mark_of_the_claw
1:14.013 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:15.234 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
1:16.862 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:18.523 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.935 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.994 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.407 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:23.819 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:25.231 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:26.644 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.055 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.466 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.526 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.587 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.587 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.999 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:34.383 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:35.421 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:36.805 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:38.189 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:39.572 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
1:40.956 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
1:42.339 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
1:43.331 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
1:44.323 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
1:45.315 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
1:46.636 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
1:47.629 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:48.975 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:50.321 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
1:51.332 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.086 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.498 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.908 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.254 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.602 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.948 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.294 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.641 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.641 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.651 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.663 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.672 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.683 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.095 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.508 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.568 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.980 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
2:12.018 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
2:13.057 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:14.440 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:15.478 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:16.516 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:17.555 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:18.615 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:20.026 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.439 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:22.851 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.199 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.547 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:26.892 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:28.239 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:29.251 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:30.598 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:31.944 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.291 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:34.703 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:36.256 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:37.670 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.016 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.026 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.374 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.721 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.731 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.079 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:46.426 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:47.437 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:48.497 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:49.909 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:51.254 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:52.264 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:53.275 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:54.285 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:55.631 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:56.641 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:57.633 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.954 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.274 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.313 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.697 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.108 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.119 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.129 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.140 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.150 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.160 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.507 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.854 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.201 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.211 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.622 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.035 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:18.095 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:19.156 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:20.566 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:21.625 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:22.683 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:23.744 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:25.156 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:26.215 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.627 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.689 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.749 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.161 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.571 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.983 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:35.367 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.687 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.007 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.998 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:40.319 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:41.641 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.395 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.741 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.753 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.164 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.577 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.989 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:50.049 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
3:50.804 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
3:51.785 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
3:52.768 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
3:53.751 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
3:54.507 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
3:55.261 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:56.243 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:57.224 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:58.206 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:59.187 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:00.171 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:01.153 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:01.908 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:01.908 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:03.568 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:04.815 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:06.476 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:07.721 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:08.966 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:10.212 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.622 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.681 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.740 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.152 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.562 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:17.946 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:19.330 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:20.370 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:21.753 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:22.792 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:23.853 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:24.835 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:25.591 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:26.575 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, mark_of_the_claw
4:27.328 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw
4:28.290 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw
4:29.046 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:30.010 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:30.973 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:31.727 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:32.689 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:33.673 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:34.427 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:35.409 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:36.657 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:38.318 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:39.564 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:41.223 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:42.885 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.298 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.646 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.992 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.340 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.686 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.033 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.378 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.725 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.784 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.291 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.702 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:58.761 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:59.821 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="mb_lvs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:5:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

tgt_eq : 1081811 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1081810.6 1081810.6 864.5 / 0.080% 159121.9 / 14.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
tgt_eq 1081811
Earth Shock 103546 9.6% 16.4 17.64sec 1893777 1957028 Direct 16.4 1342678 3719035 1893672 23.2%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.40 16.40 0.00 0.00 0.9677 0.0000 31052170.73 31052170.73 0.00 1957028.47 1957028.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.59 76.81% 1342677.60 1135077 1569506 1343051.49 1229830 1447519 16910211 16910211 0.00
crit 3.80 23.19% 3719035.25 3141892 4344393 3665937.87 0 4344393 14141959 14141959 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 60194 (92018) 5.6% (8.5%) 22.1 13.76sec 1249907 943231 Direct 22.0 582483 1612153 819624 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.03 0.00 0.00 1.3252 0.0000 18054394.75 18054394.75 0.00 943230.50 943230.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.96 76.97% 582482.58 521261 640038 582635.15 555162 613065 9876953 9876953 0.00
crit 5.07 23.03% 1612152.98 1442850 1771626 1605368.70 0 1771626 8177441 8177441 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 31824 2.9% 13.9 21.24sec 684813 0 Direct 13.9 489202 1354908 686473 22.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.93 13.90 0.00 0.00 0.0000 0.0000 9542643.26 9542643.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.73 77.21% 489202.23 437859 537632 489332.88 454838 530454 5250575 5250575 0.00
crit 3.17 22.79% 1354908.20 1211994 1488166 1307092.08 0 1488166 4292068 4292068 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 121068 11.2% 11.2 27.78sec 3227312 3362684 Direct 11.2 86394 243140 202687 74.2%  
Periodic 236.3 47595 181655 143583 71.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.34 236.34 0.9598 1.2617 36209383.45 36209383.45 0.00 117193.85 3362684.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.90 25.81% 86394.34 77837 95573 85684.72 0 95573 250182 250182 0.00
crit 8.32 74.19% 243139.53 215453 264547 243186.33 230836 255882 2023873 2023873 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.1 28.40% 47594.58 100 52566 47589.85 43636 49627 3194314 3194314 0.00
crit 169.2 71.60% 181654.76 253 203705 181754.92 170274 190138 30741015 30741015 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 118117 10.9% 38.3 7.55sec 923904 967036 Direct 38.3 652220 1807234 923877 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.32 38.32 0.00 0.00 0.9554 0.0000 35403171.71 35403171.71 0.00 967035.56 967035.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.31 76.48% 652220.18 474349 724039 652522.67 620137 683869 19113940 19113940 0.00
crit 9.01 23.52% 1807234.47 1500568 2004141 1806535.48 1632219 1984073 16289231 16289231 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 33901 (51954) 3.1% (4.8%) 9.7 32.15sec 1607331 1262495 Direct 9.7 740334 2049688 1051420 23.8%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.66 0.00 0.00 1.2732 0.0000 10160548.95 10160548.95 0.00 1262494.96 1262494.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.37 76.25% 740334.40 663371 814530 740542.13 669302 798218 5455540 5455540 0.00
crit 2.30 23.75% 2049688.45 1836210 2254619 1900375.13 0 2254619 4705009 4705009 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18053 1.7% 6.1 46.91sec 879772 0 Direct 6.1 621804 1724162 881706 23.6%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.15 6.13 0.00 0.00 0.0000 0.0000 5408538.94 5408538.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.69 76.43% 621804.29 557231 684205 620609.36 0 684205 2915272 2915272 0.00
crit 1.45 23.57% 1724162.24 1542417 1893880 1360029.06 0 1893880 2493267 2493267 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 149957 (235207) 13.9% (21.8%) 59.1 5.03sec 1193329 1022938 Direct 59.0 0 762565 762565 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.09 58.95 0.00 0.00 1.1666 0.0000 44955834.56 44955834.56 0.00 1022937.58 1022937.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.95 100.00% 762564.81 692614 850437 762672.19 741485 786714 44955835 44955835 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77073 7.1% 37.6 7.83sec 614239 0 Direct 37.5 0 616073 616073 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.62 37.51 0.00 0.00 0.0000 0.0000 23110122.97 23110122.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.51 100.00% 616073.36 559584 687093 616164.88 589977 642042 23110123 23110123 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8177 0.8% 44.2 6.18sec 55480 0 Direct 44.2 44704 91205 55480 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.18 44.18 0.00 0.00 0.0000 0.0000 2451267.76 2451267.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.94 76.83% 44703.61 42943 47934 44715.36 43080 46974 1517414 1517414 0.00
crit 10.24 23.17% 91205.47 87603 97785 91221.33 0 97785 933854 933854 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 103266 (189006) 9.6% (17.5%) 96.2 3.04sec 588823 490301 Direct 96.2 227147 632705 321655 23.3%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.21 96.21 0.00 0.00 1.2009 0.0000 30945800.76 30945800.76 0.00 490300.80 490300.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.79 76.70% 227146.55 154272 568274 227407.66 197371 259812 16760916 16760916 0.00
crit 22.42 23.30% 632705.14 427024 1572984 633216.05 452586 975817 14184885 14184885 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 85740 7.9% 93.7 3.81sec 274324 0 Direct 93.7 193996 539680 274323 23.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.70 93.70 0.00 0.00 0.0000 0.0000 25703063.45 25703063.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.92 76.76% 193996.11 129588 477350 194085.64 155268 250100 13952993 13952993 0.00
crit 21.77 23.24% 539679.63 358700 1321306 539753.44 383352 897054 11750070 11750070 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59566) 0.0% (5.5%) 3.0 120.38sec 5947044 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.78 0.00 0.0000 1.0000 0.00 0.00 0.00 306991.82 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19079 1.8% 37.7 6.98sec 150759 0 Direct 37.5 121869 248614 151348 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.68 37.53 0.00 0.00 0.0000 0.0000 5680613.39 5680613.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.81 76.74% 121869.49 121869 121869 121869.49 121869 121869 3510512 3510512 0.00
crit 8.73 23.26% 248613.77 248614 248614 248584.66 0 248614 2170101 2170101 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40487 3.7% 98.7 2.62sec 122176 0 Direct 98.4 98655 201256 122477 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.68 98.44 0.00 0.00 0.0000 0.0000 12056759.89 12056759.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.58 76.78% 98654.92 98655 98655 98654.92 98655 98655 7456810 7456810 0.00
crit 22.86 23.22% 201256.04 201256 201256 201256.04 201256 201256 4599950 4599950 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 136706 / 84746
Fire Blast 136706 7.8% 98.1 2.96sec 257875 139123 Direct 98.1 209426 418874 257875 23.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.06 98.06 0.00 0.00 1.8536 0.0000 25286439.04 25286439.04 0.00 139122.99 139122.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.37 76.87% 209425.72 199011 222144 209471.42 204643 215904 15785300 15785300 0.00
crit 22.68 23.13% 418874.14 398022 444288 418960.84 406128 434798 9501139 9501139 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186725 / 26583
Lightning Blast 186725 2.5% 42.0 6.71sec 189435 202499 Direct 42.0 153645 307339 189439 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.99 41.99 0.00 0.00 0.9355 0.0000 7955168.24 7955168.24 0.00 202498.87 202498.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.22 76.71% 153645.48 147415 164551 153678.62 148813 161413 4949695 4949695 0.00
crit 9.78 23.29% 307338.87 294831 329102 307396.98 0 329102 3005473 3005473 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
tgt_eq
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
Fire Elemental 3.4 109.59sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.38 0.00 0.00 0.00 1.0229 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.57sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8218 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 112.93sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5212 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.23% 32.23% 3.1(3.1) 8.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.6sec 68.6sec 8.75% 8.75% 0.0(0.0) 3.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.75%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.5 27.2sec 23.6sec 34.89% 34.89% 1.5(1.5) 10.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.3sec 23.7sec 34.77% 34.77% 1.4(1.4) 10.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 27.9sec 23.5sec 33.79% 33.79% 1.8(1.8) 9.9

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 71.9 26.6 4.2sec 3.0sec 59.25% 61.30% 26.6(32.5) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:25.65%
  • elemental_focus_2:33.60%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.2sec 32.2sec 20.65% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.41%
  • icefury_2:5.97%
  • icefury_3:5.03%
  • icefury_4:3.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 13.0sec 12.2sec 10.44% 39.78% 1.4(1.4) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.44%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.94% 29.94% 4.2(4.2) 12.6

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 68.9sec 68.9sec 13.58% 13.58% 0.0(0.0) 3.3

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.58%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 98.0sec 0.0sec 39.92% 39.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.4 1.4 36.9sec 30.4sec 21.76% 24.04% 1.4(3.0) 0.1

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.11%
  • power_of_the_maelstrom_2:6.30%
  • power_of_the_maelstrom_3:9.35%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.0sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.48% 8.92% 0.0(0.0) 0.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.26%
  • stormkeeper_2:3.68%
  • stormkeeper_3:4.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.0sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 76.7sec
Lava Surge: During Lava Burst 3.7 58.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6870.0015.0462.4880.0009.127
Fire Elemental0.4930.0011.7950.5420.0003.501
Lava Burst0.9060.0018.9697.4590.00025.006
Elemental Blast0.5400.0014.3338.9963.13918.295
Icefury1.0210.0017.9197.4710.68923.236

Resources

Resource Usage Type Count Total Average RPE APR
tgt_eq
earth_shock Maelstrom 133.6 16029.4 120.0 977.6 1937.2
flame_shock Maelstrom 91.4 1631.1 17.8 145.4 22200.0
frost_shock Maelstrom 312.3 6245.2 20.0 163.0 5668.9
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 481.53 5716.22 (23.48%) 11.87 62.20 1.08%
Lava Burst Overload Maelstrom 306.60 2659.25 (10.93%) 8.67 100.11 3.63%
Lightning Bolt Maelstrom 783.96 6255.28 (25.70%) 7.98 16.38 0.26%
Lightning Bolt Overload Maelstrom 763.44 4527.42 (18.60%) 5.93 53.22 1.16%
Icefury Maelstrom 78.93 1882.78 (7.74%) 23.85 11.62 0.61%
Icefury Overload Maelstrom 50.10 891.16 (3.66%) 17.79 10.56 1.17%
Resonance Totem Maelstrom 2432.06 2408.73 (9.90%) 0.99 23.32 0.96%
Resource RPS-Gain RPS-Loss
Maelstrom 9.96 9.78
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 52.98 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data tgt_eq Fight Length
Count 8540
Mean 300.00
Minimum 239.97
Maximum 360.00
Spread ( max - min ) 120.03
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.0599
5th Percentile 245.84
95th Percentile 354.12
( 95th Percentile - 5th Percentile ) 108.28
Mean Distribution
Standard Deviation 0.3902
95.00% Confidence Intervall ( 299.23 - 300.76 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 556
0.1% Error 55502
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1111
DPS
Sample Data tgt_eq Damage Per Second
Count 8540
Mean 1081810.64
Minimum 944086.60
Maximum 1249495.42
Spread ( max - min ) 305408.81
Range [ ( max - min ) / 2 * 100% ] 14.12%
Standard Deviation 40763.1447
5th Percentile 1017330.77
95th Percentile 1152171.12
( 95th Percentile - 5th Percentile ) 134840.34
Mean Distribution
Standard Deviation 441.1017
95.00% Confidence Intervall ( 1080946.10 - 1082675.18 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5455
0.1 Scale Factor Error with Delta=300 14184664
0.05 Scale Factor Error with Delta=300 56738654
0.01 Scale Factor Error with Delta=300 1418466328
Priority Target DPS
Sample Data tgt_eq Priority Target Damage Per Second
Count 8540
Mean 1081810.64
Minimum 944086.60
Maximum 1249495.42
Spread ( max - min ) 305408.81
Range [ ( max - min ) / 2 * 100% ] 14.12%
Standard Deviation 40763.1447
5th Percentile 1017330.77
95th Percentile 1152171.12
( 95th Percentile - 5th Percentile ) 134840.34
Mean Distribution
Standard Deviation 441.1017
95.00% Confidence Intervall ( 1080946.10 - 1082675.18 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5455
0.1 Scale Factor Error with Delta=300 14184664
0.05 Scale Factor Error with Delta=300 56738654
0.01 Scale Factor Error with Delta=300 1418466328
DPS(e)
Sample Data tgt_eq Damage Per Second (Effective)
Count 8540
Mean 1081810.64
Minimum 944086.60
Maximum 1249495.42
Spread ( max - min ) 305408.81
Range [ ( max - min ) / 2 * 100% ] 14.12%
Damage
Sample Data tgt_eq Damage
Count 8540
Mean 290734314.56
Minimum 210731506.65
Maximum 376054225.20
Spread ( max - min ) 165322718.55
Range [ ( max - min ) / 2 * 100% ] 28.43%
DTPS
Sample Data tgt_eq Damage Taken Per Second
Count 8540
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data tgt_eq Healing Per Second
Count 8540
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data tgt_eq Healing Per Second (Effective)
Count 8540
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data tgt_eq Heal
Count 8540
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data tgt_eq Healing Taken Per Second
Count 8540
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data tgt_eq Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data tgt_eqTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data tgt_eq Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.17 totem_mastery,if=buff.resonance_totem.remains<2
9 3.38 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.98 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.45 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.40 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.16 elemental_blast
Keep your EB always on Cooldown.
I 12.24 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.41 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.72 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.60 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 59.20 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.89 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.76 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.14 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.03 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.55 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 73.31 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNSNSSOMSSHSSSSMISSSSMRHMRIRKNNMNNOSSHMMMRRIRSMSHMMJPSSSKMNNHMNMNFRRRMIHMSSSM97SSSIKHMMNNNRNORMRQHSSMPSSASJMSHSKGNMNNOSSSHMMRIRRSMSHSPSMKNNNNMFHSSSMSSSSIHMJLLLMSOMPKMNNHNRMNRRSM9HIMSSMSSSPMHKNFNQMMNNMSHMSSAMPSJMSOSHSSMKGGNNMSHSSPMRRRMSHIMSOSMMKNNHNMNSSSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.874 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.960 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.045 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, lava_surge, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:04.862 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:05.948 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:06.764 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:07.581 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.396 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.211 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:10.028 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.843 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.659 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.474 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.561 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.649 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.737 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.824 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.910 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.948 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.984 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.019 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.057 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.836 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.873 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.910 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.945 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.981 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.761 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.848 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.935 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.022 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.108 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.924 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.012 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.128 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:35.928 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:36.727 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:37.792 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:38.594 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:39.392 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:40.191 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:41.256 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:42.667 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.077 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.136 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.149 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.495 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.842 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.188 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.197 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.545 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:53.866 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.187 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.570 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:57.953 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.990 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.401 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.459 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.519 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.578 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.638 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.698 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.111 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:08.523 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:09.583 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:10.642 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:12.054 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:13.113 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:14.171 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:15.583 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:16.643 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.703 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.116 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.528 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:21.911 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:22.951 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.989 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.433 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.753 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:28.073 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.418 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.765 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.111 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.122 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.122 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.469 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:35.405 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:36.343 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:37.097 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:38.087 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:39.071 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:39.826 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:40.788 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:41.543 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:42.300 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:43.054 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:44.017 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:44.772 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
1:45.527 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
1:47.188 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
1:48.850 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:50.511 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:51.343 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:53.006 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:54.589 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:55.909 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:57.230 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.220 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.540 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.860 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.860 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.180 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.191 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.602 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.661 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.073 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.082 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.429 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
2:10.438 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
2:11.448 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
2:12.794 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
2:13.804 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.817 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:15.827 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.837 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:18.183 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:19.594 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.006 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:22.066 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:23.477 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:24.889 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.949 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.361 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.774 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.184 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.594 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:33.005 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:34.417 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.829 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:36.889 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:38.297 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.707 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.118 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:42.178 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:43.236 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:44.294 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:45.353 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.767 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.804 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.188 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.509 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.829 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.174 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.521 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.866 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.214 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.562 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.909 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.968 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.594 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.006 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:04.761 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:05.517 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:06.272 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:07.027 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:07.781 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:08.717 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:09.472 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:10.407 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:11.162 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:12.099 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact
3:12.854 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact
3:13.608 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact
3:14.364 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
3:15.571 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
3:16.324 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due
3:17.986 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due
3:19.647 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due
3:20.895 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:22.555 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:24.215 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.626 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.011 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.049 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.432 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.472 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.510 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.920 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.333 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.745 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.155 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:38.566 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.978 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:41.037 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:42.448 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:43.861 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:45.273 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:46.331 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:47.392 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:48.452 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:49.205 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:50.264 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:51.677 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:52.737 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:53.776 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:54.815 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.200 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:57.586 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.908 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.230 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.551 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.551 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.541 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.551 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.898 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.909 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.255 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.264 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.324 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.384 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.795 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.854 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.265 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.677 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.088 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:18.148 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:19.209 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:20.267 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:21.327 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.738 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.148 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.560 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.971 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.384 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.447 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.859 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.271 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.684 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.098 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.158 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.571 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.955 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.995 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.378 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.763 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.823 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.234 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.294 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.706 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.117 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:50.179 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:51.238 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:52.649 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:53.709 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
4:55.055 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
4:56.047 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:57.367 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:58.688 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:59.607 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="tgt_eq"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:5:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Simulation & Raid Information

Iterations: 8556
Threads: 8
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 363983438
Max Event Queue: 53
Sim Seconds: 2566813
CPU Seconds: 226.4219
Physical Seconds: 30.0167
Speed Up: 11336

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
1ilevel 1ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
1ilevel 1ilevel earth_shock 8042 31269210 104229 3.28 1347264 3733270 16.4 16.4 23.5% 0.0% 0.0% 0.0% 17.63sec 31269210 300.01sec
1ilevel 1ilevel elemental_blast 117014 18096957 60322 4.41 584379 1617789 22.1 22.0 22.9% 0.0% 0.0% 0.0% 13.76sec 18096957 300.01sec
1ilevel 1ilevel elemental_blast_overload 120588 9613117 32043 2.79 490960 1358808 14.0 14.0 22.8% 0.0% 0.0% 0.0% 21.16sec 9613117 300.01sec
1ilevel 1ilevel fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.67sec 0 300.01sec
1ilevel 1ilevel flame_shock 188389 2282780 7609 2.24 86771 243922 11.2 11.2 74.2% 0.0% 0.0% 0.0% 27.77sec 36324359 300.01sec
1ilevel 1ilevel flame_shock ticks -188389 34041579 113472 47.26 47763 182303 11.2 236.3 71.6% 0.0% 0.0% 0.0% 27.77sec 36324359 300.01sec
1ilevel 1ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
1ilevel 1ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
1ilevel 1ilevel frost_shock 196840 35537352 118456 7.66 654875 1813806 38.3 38.3 23.5% 0.0% 0.0% 0.0% 7.54sec 35537352 300.01sec
1ilevel 1ilevel icefury 210714 10155947 33853 1.93 742970 2059340 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.15sec 10155947 300.01sec
1ilevel 1ilevel icefury_overload 219271 5436259 18121 1.24 624138 1729312 6.2 6.2 23.2% 0.0% 0.0% 0.0% 47.31sec 5436259 300.01sec
1ilevel 1ilevel lava_burst 51505 45058286 150192 11.78 0 765259 59.0 58.9 100.0% 0.0% 0.0% 0.0% 5.04sec 45058286 300.01sec
1ilevel 1ilevel lava_burst_overload 77451 23137972 77125 7.49 0 618228 37.5 37.4 100.0% 0.0% 0.0% 0.0% 7.89sec 23137972 300.01sec
1ilevel 1ilevel volcanic_inferno 205533 2446860 8156 8.78 44874 91542 43.9 43.9 23.3% 0.0% 0.0% 0.0% 6.21sec 2446860 300.01sec
1ilevel 1ilevel lightning_bolt 188196 31054802 103514 19.25 228053 634829 96.2 96.2 23.3% 0.0% 0.0% 0.0% 3.03sec 31054802 300.01sec
1ilevel 1ilevel lightning_bolt_overload 45284 25784082 85945 18.74 194657 540773 93.7 93.7 23.2% 0.0% 0.0% 0.0% 3.79sec 25784082 300.01sec
1ilevel 1ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
1ilevel 1ilevel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.37sec 0 300.01sec
1ilevel 1ilevel spectral_blast 246442 5678286 18927 7.50 121869 248614 37.7 37.5 23.3% 0.0% 0.0% 0.0% 6.96sec 5678286 300.01sec
1ilevel 1ilevel spectral_bolt 242571 12066724 40222 19.72 98655 201256 98.9 98.6 23.1% 0.0% 0.0% 0.0% 2.62sec 12066724 300.01sec
1ilevel 1ilevel stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.56sec 0 300.01sec
1ilevel 1ilevel totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.05sec 0 300.01sec
1ilevel 1ilevel_primal_fire_elemental fire_blast 57984 25362208 136904 31.75 210183 420441 98.0 98.0 23.1% 0.0% 0.0% 0.0% 2.96sec 25362208 185.26sec
1ilevel 1ilevel_greater_lightning_elemental lightning_blast 191726 7988201 186983 59.11 154163 308399 42.1 42.1 23.1% 0.0% 0.0% 0.0% 6.69sec 7988201 42.72sec
2ilevel 2ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
2ilevel 2ilevel earth_shock 8042 31409058 104693 3.28 1352971 3746238 16.4 16.4 23.5% 0.0% 0.0% 0.0% 17.60sec 31409058 300.01sec
2ilevel 2ilevel elemental_blast 117014 18242347 60806 4.41 586617 1624402 22.1 22.0 23.2% 0.0% 0.0% 0.0% 13.76sec 18242347 300.01sec
2ilevel 2ilevel elemental_blast_overload 120588 9683248 32276 2.79 492879 1363696 14.0 14.0 23.1% 0.0% 0.0% 0.0% 21.10sec 9683248 300.01sec
2ilevel 2ilevel fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.50sec 0 300.01sec
2ilevel 2ilevel flame_shock 188389 2291629 7638 2.24 87038 244894 11.2 11.2 74.3% 0.0% 0.0% 0.0% 27.77sec 36481911 300.01sec
2ilevel 2ilevel flame_shock ticks -188389 34190281 113968 47.28 47954 182971 11.2 236.4 71.6% 0.0% 0.0% 0.0% 27.77sec 36481911 300.01sec
2ilevel 2ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
2ilevel 2ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
2ilevel 2ilevel frost_shock 196840 35704225 119010 7.67 657247 1819975 38.3 38.3 23.6% 0.0% 0.0% 0.0% 7.55sec 35704225 300.01sec
2ilevel 2ilevel icefury 210714 10220245 34066 1.93 745689 2066876 9.7 9.7 23.6% 0.0% 0.0% 0.0% 32.16sec 10220245 300.01sec
2ilevel 2ilevel icefury_overload 219271 5480532 18268 1.24 626606 1735908 6.2 6.2 23.4% 0.0% 0.0% 0.0% 46.75sec 5480532 300.01sec
2ilevel 2ilevel lava_burst 51505 45215129 150711 11.77 0 768251 59.0 58.9 100.0% 0.0% 0.0% 0.0% 5.04sec 45215129 300.01sec
2ilevel 2ilevel lava_burst_overload 77451 23231451 77435 7.49 0 620702 37.6 37.4 100.0% 0.0% 0.0% 0.0% 7.82sec 23231451 300.01sec
2ilevel 2ilevel volcanic_inferno 205533 2446334 8154 8.75 45045 91902 43.8 43.8 23.2% 0.0% 0.0% 0.0% 6.26sec 2446334 300.01sec
2ilevel 2ilevel lightning_bolt 188196 31147582 103821 19.26 228950 635871 96.3 96.3 23.2% 0.0% 0.0% 0.0% 3.04sec 31147582 300.01sec
2ilevel 2ilevel lightning_bolt_overload 45284 25941669 86469 18.79 195526 543616 93.9 93.9 23.2% 0.0% 0.0% 0.0% 3.79sec 25941669 300.01sec
2ilevel 2ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
2ilevel 2ilevel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.01sec
2ilevel 2ilevel spectral_blast 246442 5666928 18889 7.49 121869 248614 37.6 37.4 23.3% 0.0% 0.0% 0.0% 6.95sec 5666928 300.01sec
2ilevel 2ilevel spectral_bolt 242571 12048228 40159 19.69 98655 201256 98.7 98.5 23.1% 0.0% 0.0% 0.0% 2.62sec 12048228 300.01sec
2ilevel 2ilevel stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.59sec 0 300.01sec
2ilevel 2ilevel totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.04sec 0 300.01sec
2ilevel 2ilevel_primal_fire_elemental fire_blast 57984 25497563 137602 31.77 210961 422051 98.1 98.1 23.2% 0.0% 0.0% 0.0% 2.95sec 25497563 185.30sec
2ilevel 2ilevel_greater_lightning_elemental lightning_blast 191726 8022308 188212 59.19 154771 309596 42.1 42.1 23.3% 0.0% 0.0% 0.0% 6.73sec 8022308 42.62sec
3ilevel 3ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel earth_shock 8042 31579334 105265 3.28 1357670 3760252 16.4 16.4 23.6% 0.0% 0.0% 0.0% 17.57sec 31579334 300.00sec
3ilevel 3ilevel elemental_blast 117014 18278409 60928 4.41 588967 1629931 22.1 22.0 23.1% 0.0% 0.0% 0.0% 13.76sec 18278409 300.00sec
3ilevel 3ilevel elemental_blast_overload 120588 9680309 32268 2.79 494768 1369619 14.0 13.9 22.8% 0.0% 0.0% 0.0% 21.02sec 9680309 300.00sec
3ilevel 3ilevel fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.66sec 0 300.00sec
3ilevel 3ilevel flame_shock 188389 2299928 7666 2.24 87373 245794 11.2 11.2 74.3% 0.0% 0.0% 0.0% 27.78sec 36599830 300.00sec
3ilevel 3ilevel flame_shock ticks -188389 34299903 114333 47.27 48126 183660 11.2 236.4 71.6% 0.0% 0.0% 0.0% 27.78sec 36599830 300.00sec
3ilevel 3ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel frost_shock 196840 35804828 119350 7.66 659792 1827439 38.3 38.3 23.5% 0.0% 0.0% 0.0% 7.55sec 35804828 300.00sec
3ilevel 3ilevel icefury 210714 10243906 34147 1.93 748654 2074154 9.7 9.7 23.5% 0.0% 0.0% 0.0% 32.16sec 10243906 300.00sec
3ilevel 3ilevel icefury_overload 219271 5480771 18269 1.24 629201 1742156 6.2 6.2 23.1% 0.0% 0.0% 0.0% 47.29sec 5480771 300.00sec
3ilevel 3ilevel lava_burst 51505 45434937 151451 11.78 0 771128 59.1 58.9 100.0% 0.0% 0.0% 0.0% 5.02sec 45434937 300.00sec
3ilevel 3ilevel lava_burst_overload 77451 23383830 77947 7.51 0 623062 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.83sec 23383830 300.00sec
3ilevel 3ilevel volcanic_inferno 205533 2466749 8223 8.80 45212 92216 44.0 44.0 23.1% 0.0% 0.0% 0.0% 6.13sec 2466749 300.00sec
3ilevel 3ilevel lightning_bolt 188196 31251883 104174 19.25 229782 638268 96.2 96.2 23.2% 0.0% 0.0% 0.0% 3.03sec 31251883 300.00sec
3ilevel 3ilevel lightning_bolt_overload 45284 26001319 86672 18.77 196006 546119 93.8 93.8 23.2% 0.0% 0.0% 0.0% 3.79sec 26001319 300.00sec
3ilevel 3ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.39sec 0 300.00sec
3ilevel 3ilevel spectral_blast 246442 5679012 18930 7.50 121869 248614 37.7 37.5 23.3% 0.0% 0.0% 0.0% 6.97sec 5679012 300.00sec
3ilevel 3ilevel spectral_bolt 242571 12070730 40236 19.73 98655 201256 98.9 98.6 23.1% 0.0% 0.0% 0.0% 2.61sec 12070730 300.00sec
3ilevel 3ilevel stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.00sec
3ilevel 3ilevel totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.01sec 0 300.00sec
3ilevel 3ilevel_primal_fire_elemental fire_blast 57984 25570903 138156 31.76 211794 423635 98.0 98.0 23.2% 0.0% 0.0% 0.0% 2.96sec 25570903 185.09sec
3ilevel 3ilevel_greater_lightning_elemental lightning_blast 191726 8051831 188742 59.17 155312 310619 42.1 42.1 23.2% 0.0% 0.0% 0.0% 6.70sec 8051831 42.66sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline earth_shock 8042 31113618 103710 3.28 1342922 3716995 16.4 16.4 23.4% 0.0% 0.0% 0.0% 17.61sec 31113618 300.00sec
baseline baseline elemental_blast 117014 18064754 60215 4.41 582235 1611528 22.1 22.0 23.1% 0.0% 0.0% 0.0% 13.76sec 18064754 300.00sec
baseline baseline elemental_blast_overload 120588 9611160 32037 2.79 489127 1353396 14.0 14.0 23.0% 0.0% 0.0% 0.0% 21.04sec 9611160 300.00sec
baseline baseline fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.57sec 0 300.00sec
baseline baseline flame_shock 188389 2274863 7583 2.24 86444 243088 11.2 11.2 74.3% 0.0% 0.0% 0.0% 27.78sec 36173279 300.00sec
baseline baseline flame_shock ticks -188389 33898415 112995 47.26 47591 181655 11.2 236.3 71.5% 0.0% 0.0% 0.0% 27.78sec 36173279 300.00sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline frost_shock 196840 35443304 118142 7.66 652351 1807231 38.3 38.3 23.6% 0.0% 0.0% 0.0% 7.54sec 35443304 300.00sec
baseline baseline icefury 210714 10101962 33673 1.93 740305 2051713 9.7 9.7 23.2% 0.0% 0.0% 0.0% 32.16sec 10101962 300.00sec
baseline baseline icefury_overload 219271 5416357 18054 1.23 622231 1723858 6.2 6.2 23.4% 0.0% 0.0% 0.0% 47.49sec 5416357 300.00sec
baseline baseline lava_burst 51505 44951490 149836 11.79 0 762407 59.1 59.0 100.0% 0.0% 0.0% 0.0% 5.02sec 44951490 300.00sec
baseline baseline lava_burst_overload 77451 23092023 76972 7.50 0 615940 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.90sec 23092023 300.00sec
baseline baseline volcanic_inferno 205533 2439049 8130 8.79 44708 91222 43.9 43.9 23.2% 0.0% 0.0% 0.0% 6.14sec 2439049 300.00sec
baseline baseline lightning_bolt 188196 30856984 102855 19.23 227190 631529 96.2 96.2 23.2% 0.0% 0.0% 0.0% 3.04sec 30856984 300.00sec
baseline baseline lightning_bolt_overload 45284 25678874 85595 18.73 193911 540171 93.6 93.6 23.2% 0.0% 0.0% 0.0% 3.80sec 25678874 300.00sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.40sec 0 300.00sec
baseline baseline spectral_blast 246442 5686824 18956 7.52 121869 248614 37.7 37.6 23.2% 0.0% 0.0% 0.0% 6.94sec 5686824 300.00sec
baseline baseline spectral_bolt 242571 12071628 40238 19.73 98655 201256 98.9 98.6 23.1% 0.0% 0.0% 0.0% 2.62sec 12071628 300.00sec
baseline baseline stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.59sec 0 300.00sec
baseline baseline totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.96sec 0 300.00sec
baseline baseline_primal_fire_elemental fire_blast 57984 25262133 136446 31.74 209433 418902 97.9 97.9 23.2% 0.0% 0.0% 0.0% 2.95sec 25262133 185.14sec
baseline baseline_greater_lightning_elemental lightning_blast 191726 7946592 186355 59.10 153580 307192 42.0 42.0 23.2% 0.0% 0.0% 0.0% 6.70sec 7946592 42.64sec
ctt_nature ctt_nature augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ctt_nature ctt_nature earth_shock 8042 31363667 104546 3.28 1355690 3752534 16.4 16.4 23.3% 0.0% 0.0% 0.0% 17.64sec 31363667 300.00sec
ctt_nature ctt_nature elemental_blast 117014 18224454 60748 4.41 587882 1628114 22.1 22.0 23.0% 0.0% 0.0% 0.0% 13.76sec 18224454 300.00sec
ctt_nature ctt_nature elemental_blast_overload 120588 9632327 32108 2.78 493864 1367490 13.9 13.9 22.7% 0.0% 0.0% 0.0% 21.14sec 9632327 300.00sec
ctt_nature ctt_nature fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.66sec 0 300.00sec
ctt_nature ctt_nature flame_shock 188389 2271196 7571 2.24 86382 243078 11.2 11.2 74.2% 0.0% 0.0% 0.0% 27.79sec 36187049 300.00sec
ctt_nature ctt_nature flame_shock ticks -188389 33915854 113053 47.25 47575 181654 11.2 236.3 71.6% 0.0% 0.0% 0.0% 27.79sec 36187049 300.00sec
ctt_nature ctt_nature flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ctt_nature ctt_nature food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ctt_nature ctt_nature frost_shock 196840 35384726 117950 7.66 652373 1807079 38.3 38.3 23.5% 0.0% 0.0% 0.0% 7.55sec 35384726 300.00sec
ctt_nature ctt_nature icefury 210714 10092740 33643 1.93 740128 2051010 9.7 9.7 23.2% 0.0% 0.0% 0.0% 32.16sec 10092740 300.00sec
ctt_nature ctt_nature icefury_overload 219271 5426978 18090 1.23 621843 1723272 6.2 6.2 23.5% 0.0% 0.0% 0.0% 47.27sec 5426978 300.00sec
ctt_nature ctt_nature lava_burst 51505 44898394 149662 11.78 0 762411 59.0 58.9 100.0% 0.0% 0.0% 0.0% 5.04sec 44898394 300.00sec
ctt_nature ctt_nature lava_burst_overload 77451 23081408 76938 7.49 0 615943 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.83sec 23081408 300.00sec
ctt_nature ctt_nature volcanic_inferno 205533 2433855 8113 8.77 44714 91208 43.9 43.9 23.2% 0.0% 0.0% 0.0% 6.17sec 2433855 300.00sec
ctt_nature ctt_nature lightning_bolt 188196 31207264 104025 19.24 229472 637946 96.2 96.2 23.2% 0.0% 0.0% 0.0% 3.03sec 31207264 300.00sec
ctt_nature ctt_nature lightning_bolt_overload 45284 25964699 86549 18.74 195919 545805 93.7 93.7 23.2% 0.0% 0.0% 0.0% 3.81sec 25964699 300.00sec
ctt_nature ctt_nature potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ctt_nature ctt_nature spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.40sec 0 300.00sec
ctt_nature ctt_nature spectral_blast 246442 5675671 18919 7.50 121869 248614 37.6 37.5 23.3% 0.0% 0.0% 0.0% 6.96sec 5675671 300.00sec
ctt_nature ctt_nature spectral_bolt 242571 12042060 40140 19.67 98655 201256 98.6 98.3 23.2% 0.0% 0.0% 0.0% 2.62sec 12042060 300.00sec
ctt_nature ctt_nature stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.00sec
ctt_nature ctt_nature totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.13sec 0 300.00sec
ctt_nature ctt_nature_primal_fire_elemental fire_blast 57984 25275556 136401 31.74 209447 418854 98.0 98.0 23.1% 0.0% 0.0% 0.0% 2.96sec 25275556 185.30sec
ctt_nature ctt_nature_greater_lightning_elemental lightning_blast 191726 7954766 186328 59.11 153574 307163 42.1 42.1 23.2% 0.0% 0.0% 0.0% 6.73sec 7954766 42.69sec
ea_es ea_es augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ea_es ea_es earth_shock 8042 32251207 107497 3.28 1388723 3843244 16.4 16.4 23.6% 0.0% 0.0% 0.0% 17.60sec 32251207 300.02sec
ea_es ea_es elemental_blast 117014 18065839 60216 4.41 582304 1611880 22.1 22.0 23.1% 0.0% 0.0% 0.0% 13.76sec 18065839 300.02sec
ea_es ea_es elemental_blast_overload 120588 9568655 31894 2.79 489184 1353430 14.0 13.9 22.9% 0.0% 0.0% 0.0% 21.09sec 9568655 300.02sec
ea_es ea_es fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.75sec 0 300.02sec
ea_es ea_es flame_shock 188389 2275654 7585 2.24 86450 243121 11.2 11.2 74.2% 0.0% 0.0% 0.0% 27.77sec 36217865 300.02sec
ea_es ea_es flame_shock ticks -188389 33942212 113141 47.27 47601 181676 11.2 236.3 71.6% 0.0% 0.0% 0.0% 27.77sec 36217865 300.02sec
ea_es ea_es flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ea_es ea_es food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ea_es ea_es frost_shock 196840 35384496 117941 7.66 652347 1805852 38.3 38.3 23.5% 0.0% 0.0% 0.0% 7.54sec 35384496 300.02sec
ea_es ea_es icefury 210714 10149428 33829 1.93 740328 2051697 9.7 9.7 23.6% 0.0% 0.0% 0.0% 32.16sec 10149428 300.02sec
ea_es ea_es icefury_overload 219271 5419153 18063 1.23 621853 1724355 6.2 6.2 23.2% 0.0% 0.0% 0.0% 46.67sec 5419153 300.02sec
ea_es ea_es lava_burst 51505 44894515 149639 11.77 0 762503 59.0 58.9 100.0% 0.0% 0.0% 0.0% 5.05sec 44894515 300.02sec
ea_es ea_es lava_burst_overload 77451 23058933 76858 7.49 0 615980 37.6 37.4 100.0% 0.0% 0.0% 0.0% 7.87sec 23058933 300.02sec
ea_es ea_es volcanic_inferno 205533 2431986 8106 8.77 44709 91204 43.8 43.8 23.2% 0.0% 0.0% 0.0% 6.18sec 2431986 300.02sec
ea_es ea_es lightning_bolt 188196 30910706 103029 19.25 227140 631586 96.3 96.3 23.2% 0.0% 0.0% 0.0% 3.03sec 30910706 300.02sec
ea_es ea_es lightning_bolt_overload 45284 25700114 85662 18.73 193935 539245 93.6 93.6 23.3% 0.0% 0.0% 0.0% 3.79sec 25700114 300.02sec
ea_es ea_es potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ea_es ea_es spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.39sec 0 300.02sec
ea_es ea_es spectral_blast 246442 5661821 18872 7.48 121869 248614 37.6 37.4 23.3% 0.0% 0.0% 0.0% 6.98sec 5661821 300.02sec
ea_es ea_es spectral_bolt 242571 12020672 40066 19.65 98655 201256 98.5 98.2 23.1% 0.0% 0.0% 0.0% 2.61sec 12020672 300.02sec
ea_es ea_es stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.02sec
ea_es ea_es totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.00sec 0 300.02sec
ea_es ea_es_primal_fire_elemental fire_blast 57984 25309470 136490 31.75 209411 418830 98.1 98.1 23.2% 0.0% 0.0% 0.0% 2.96sec 25309470 185.43sec
ea_es ea_es_greater_lightning_elemental lightning_blast 191726 7952504 186643 59.14 153598 307249 42.0 42.0 23.3% 0.0% 0.0% 0.0% 6.74sec 7952504 42.61sec
ede_crit ede_crit augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit earth_shock 8042 31381829 104604 3.28 1342881 3787800 16.4 16.4 23.3% 0.0% 0.0% 0.0% 17.61sec 31381829 300.01sec
ede_crit ede_crit elemental_blast 117014 18225828 60752 4.41 582529 1642566 22.1 22.0 23.1% 0.0% 0.0% 0.0% 13.76sec 18225828 300.01sec
ede_crit ede_crit elemental_blast_overload 120588 9681723 32272 2.79 489247 1380485 14.0 13.9 23.0% 0.0% 0.0% 0.0% 20.98sec 9681723 300.01sec
ede_crit ede_crit fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.79sec 0 300.01sec
ede_crit ede_crit flame_shock 188389 2310940 7703 2.24 86449 247616 11.2 11.2 74.2% 0.0% 0.0% 0.0% 27.79sec 36818496 300.01sec
ede_crit ede_crit flame_shock ticks -188389 34507557 115025 47.28 47597 185061 11.2 236.4 71.6% 0.0% 0.0% 0.0% 27.79sec 36818496 300.01sec
ede_crit ede_crit flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit frost_shock 196840 35715481 119050 7.67 652310 1840053 38.3 38.3 23.5% 0.0% 0.0% 0.0% 7.54sec 35715481 300.01sec
ede_crit ede_crit icefury 210714 10213309 34044 1.93 740188 2089021 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.15sec 10213309 300.01sec
ede_crit ede_crit icefury_overload 219271 5463352 18211 1.23 621946 1754495 6.2 6.2 23.3% 0.0% 0.0% 0.0% 47.34sec 5463352 300.01sec
ede_crit ede_crit lava_burst 51505 45880257 152932 11.80 0 777606 59.1 59.0 100.0% 0.0% 0.0% 0.0% 5.02sec 45880257 300.01sec
ede_crit ede_crit lava_burst_overload 77451 23524860 78415 7.50 0 626961 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.88sec 23524860 300.01sec
ede_crit ede_crit volcanic_inferno 205533 2440295 8134 8.80 44713 91206 44.0 44.0 23.1% 0.0% 0.0% 0.0% 6.19sec 2440295 300.01sec
ede_crit ede_crit lightning_bolt 188196 31148860 103828 19.23 227381 642677 96.2 96.2 23.2% 0.0% 0.0% 0.0% 3.04sec 31148860 300.01sec
ede_crit ede_crit lightning_bolt_overload 45284 25977820 86591 18.79 194103 549835 93.9 93.9 23.2% 0.0% 0.0% 0.0% 3.80sec 25977820 300.01sec
ede_crit ede_crit potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.39sec 0 300.01sec
ede_crit ede_crit spectral_blast 246442 5683277 18944 7.51 121869 248614 37.7 37.6 23.3% 0.0% 0.0% 0.0% 6.98sec 5683277 300.01sec
ede_crit ede_crit spectral_bolt 242571 12079205 40263 19.75 98655 201256 99.0 98.7 23.1% 0.0% 0.0% 0.0% 2.61sec 12079205 300.01sec
ede_crit ede_crit stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.01sec
ede_crit ede_crit totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.03sec 0 300.01sec
ede_crit ede_crit_primal_fire_elemental fire_blast 57984 25279887 136502 31.77 209418 418877 98.0 98.0 23.1% 0.0% 0.0% 0.0% 2.95sec 25279887 185.20sec
ede_crit ede_crit_greater_lightning_elemental lightning_blast 191726 7960232 186364 59.13 153613 307241 42.1 42.1 23.1% 0.0% 0.0% 0.0% 6.72sec 7960232 42.71sec
edi_cl edi_cl augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl earth_shock 8042 31107023 103688 3.28 1341964 3719224 16.4 16.4 23.4% 0.0% 0.0% 0.0% 17.60sec 31107023 300.01sec
edi_cl edi_cl elemental_blast 117014 18029579 60098 4.40 582397 1611505 22.1 22.0 23.0% 0.0% 0.0% 0.0% 13.76sec 18029579 300.01sec
edi_cl edi_cl elemental_blast_overload 120588 9586464 31954 2.78 489072 1353685 13.9 13.9 23.1% 0.0% 0.0% 0.0% 21.29sec 9586464 300.01sec
edi_cl edi_cl fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.95sec 0 300.01sec
edi_cl edi_cl flame_shock 188389 2276090 7587 2.24 86390 243048 11.2 11.2 74.3% 0.0% 0.0% 0.0% 27.78sec 36190217 300.01sec
edi_cl edi_cl flame_shock ticks -188389 33914127 113047 47.27 47578 181658 11.2 236.3 71.5% 0.0% 0.0% 0.0% 27.78sec 36190217 300.01sec
edi_cl edi_cl flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl frost_shock 196840 35421798 118071 7.67 652419 1807111 38.3 38.3 23.5% 0.0% 0.0% 0.0% 7.55sec 35421798 300.01sec
edi_cl edi_cl icefury 210714 10138001 33793 1.93 740047 2050262 9.7 9.7 23.6% 0.0% 0.0% 0.0% 32.15sec 10138001 300.01sec
edi_cl edi_cl icefury_overload 219271 5401999 18006 1.23 621907 1722216 6.2 6.2 23.2% 0.0% 0.0% 0.0% 47.05sec 5401999 300.01sec
edi_cl edi_cl lava_burst 51505 44887044 149621 11.77 0 762466 59.0 58.9 100.0% 0.0% 0.0% 0.0% 5.03sec 44887044 300.01sec
edi_cl edi_cl lava_burst_overload 77451 23077617 76924 7.49 0 615952 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.82sec 23077617 300.01sec
edi_cl edi_cl volcanic_inferno 205533 2434288 8114 8.77 44713 91220 43.9 43.9 23.2% 0.0% 0.0% 0.0% 6.17sec 2434288 300.01sec
edi_cl edi_cl lightning_bolt 188196 30936039 103118 19.25 227264 631930 96.3 96.3 23.3% 0.0% 0.0% 0.0% 3.04sec 30936039 300.01sec
edi_cl edi_cl lightning_bolt_overload 45284 25660873 85535 18.70 194180 539125 93.5 93.5 23.3% 0.0% 0.0% 0.0% 3.81sec 25660873 300.01sec
edi_cl edi_cl potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.01sec
edi_cl edi_cl spectral_blast 246442 5680549 18935 7.51 121869 248614 37.7 37.6 23.2% 0.0% 0.0% 0.0% 6.96sec 5680549 300.01sec
edi_cl edi_cl spectral_bolt 242571 12071161 40237 19.72 98655 201256 98.9 98.6 23.1% 0.0% 0.0% 0.0% 2.62sec 12071161 300.01sec
edi_cl edi_cl stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.01sec
edi_cl edi_cl totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.14sec 0 300.01sec
edi_cl edi_cl_primal_fire_elemental fire_blast 57984 25275693 136539 31.76 209438 418910 98.0 98.0 23.1% 0.0% 0.0% 0.0% 2.96sec 25275693 185.12sec
edi_cl edi_cl_greater_lightning_elemental lightning_blast 191726 7959068 186358 59.12 153605 307252 42.1 42.1 23.1% 0.0% 0.0% 0.0% 6.72sec 7959068 42.71sec
fs_fs fs_fs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
fs_fs fs_fs earth_shock 8042 31186458 103955 3.28 1342449 3716707 16.4 16.4 23.6% 0.0% 0.0% 0.0% 17.58sec 31186458 300.00sec
fs_fs fs_fs elemental_blast 117014 18043286 60145 4.41 582388 1611875 22.1 22.0 23.0% 0.0% 0.0% 0.0% 13.77sec 18043286 300.00sec
fs_fs fs_fs elemental_blast_overload 120588 9577475 31925 2.78 489170 1355039 13.9 13.9 23.0% 0.0% 0.0% 0.0% 21.25sec 9577475 300.00sec
fs_fs fs_fs fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.98sec 0 300.00sec
fs_fs fs_fs flame_shock 188389 2412539 8042 2.24 91666 257789 11.2 11.2 74.3% 0.0% 0.0% 0.0% 27.79sec 38388259 300.00sec
fs_fs fs_fs flame_shock ticks -188389 35975721 119919 47.26 50467 192651 11.2 236.3 71.6% 0.0% 0.0% 0.0% 27.79sec 38388259 300.00sec
fs_fs fs_fs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
fs_fs fs_fs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
fs_fs fs_fs frost_shock 196840 35449322 118165 7.67 652467 1807156 38.3 38.3 23.6% 0.0% 0.0% 0.0% 7.55sec 35449322 300.00sec
fs_fs fs_fs icefury 210714 10122647 33742 1.93 740188 2051684 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.15sec 10122647 300.00sec
fs_fs fs_fs icefury_overload 219271 5435834 18120 1.24 622070 1723894 6.2 6.2 23.2% 0.0% 0.0% 0.0% 47.17sec 5435834 300.00sec
fs_fs fs_fs lava_burst 51505 44930949 149771 11.78 0 762537 59.1 58.9 100.0% 0.0% 0.0% 0.0% 5.03sec 44930949 300.00sec
fs_fs fs_fs lava_burst_overload 77451 23087895 76960 7.50 0 616031 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.88sec 23087895 300.00sec
fs_fs fs_fs volcanic_inferno 205533 2429657 8099 8.76 44705 91183 43.8 43.8 23.1% 0.0% 0.0% 0.0% 6.18sec 2429657 300.00sec
fs_fs fs_fs lightning_bolt 188196 30902273 103008 19.24 227336 631141 96.2 96.2 23.2% 0.0% 0.0% 0.0% 3.03sec 30902273 300.00sec
fs_fs fs_fs lightning_bolt_overload 45284 25718315 85728 18.74 194044 539736 93.7 93.7 23.3% 0.0% 0.0% 0.0% 3.80sec 25718315 300.00sec
fs_fs fs_fs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
fs_fs fs_fs spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.00sec
fs_fs fs_fs spectral_blast 246442 5670034 18900 7.49 121869 248614 37.6 37.5 23.2% 0.0% 0.0% 0.0% 6.95sec 5670034 300.00sec
fs_fs fs_fs spectral_bolt 242571 12067995 40227 19.71 98655 201256 98.8 98.5 23.2% 0.0% 0.0% 0.0% 2.61sec 12067995 300.00sec
fs_fs fs_fs stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.59sec 0 300.00sec
fs_fs fs_fs totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.89sec 0 300.00sec
fs_fs fs_fs_primal_fire_elemental fire_blast 57984 25293889 136596 31.76 209443 418888 98.0 98.0 23.2% 0.0% 0.0% 0.0% 2.95sec 25293889 185.17sec
fs_fs fs_fs_greater_lightning_elemental lightning_blast 191726 7956560 186435 59.13 153576 307182 42.1 42.1 23.2% 0.0% 0.0% 0.0% 6.71sec 7956560 42.68sec
li_lvb li_lvb augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
li_lvb li_lvb earth_shock 8042 31138159 103799 3.28 1343260 3718692 16.4 16.4 23.5% 0.0% 0.0% 0.0% 17.61sec 31138159 299.98sec
li_lvb li_lvb elemental_blast 117014 18073209 60247 4.41 582421 1611781 22.1 22.0 23.1% 0.0% 0.0% 0.0% 13.76sec 18073209 299.98sec
li_lvb li_lvb elemental_blast_overload 120588 9564459 31883 2.79 489163 1354322 14.0 13.9 22.8% 0.0% 0.0% 0.0% 21.23sec 9564459 299.98sec
li_lvb li_lvb fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.91sec 0 299.98sec
li_lvb li_lvb flame_shock 188389 2272707 7576 2.24 86424 243026 11.2 11.2 74.2% 0.0% 0.0% 0.0% 27.77sec 36188158 299.98sec
li_lvb li_lvb flame_shock ticks -188389 33915451 113052 47.25 47587 181666 11.2 236.3 71.6% 0.0% 0.0% 0.0% 27.77sec 36188158 299.98sec
li_lvb li_lvb flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
li_lvb li_lvb food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
li_lvb li_lvb frost_shock 196840 35435853 118126 7.67 652410 1807018 38.3 38.3 23.6% 0.0% 0.0% 0.0% 7.55sec 35435853 299.98sec
li_lvb li_lvb icefury 210714 10111480 33707 1.93 740520 2050768 9.7 9.7 23.3% 0.0% 0.0% 0.0% 32.15sec 10111480 299.98sec
li_lvb li_lvb icefury_overload 219271 5445043 18151 1.23 622173 1722404 6.2 6.2 23.7% 0.0% 0.0% 0.0% 47.05sec 5445043 299.98sec
li_lvb li_lvb lava_burst 51505 46034086 153455 11.76 0 782800 59.0 58.8 100.0% 0.0% 0.0% 0.0% 5.04sec 46034086 299.98sec
li_lvb li_lvb lava_burst_overload 77451 23664619 78886 7.48 0 632444 37.5 37.4 100.0% 0.0% 0.0% 0.0% 7.86sec 23664619 299.98sec
li_lvb li_lvb volcanic_inferno 205533 2431898 8107 8.76 44721 91236 43.8 43.8 23.2% 0.0% 0.0% 0.0% 6.21sec 2431898 299.98sec
li_lvb li_lvb lightning_bolt 188196 30893746 102985 19.25 227177 632563 96.2 96.2 23.1% 0.0% 0.0% 0.0% 3.04sec 30893746 299.98sec
li_lvb li_lvb lightning_bolt_overload 45284 25765429 85889 18.76 194089 540116 93.8 93.8 23.3% 0.0% 0.0% 0.0% 3.79sec 25765429 299.98sec
li_lvb li_lvb potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
li_lvb li_lvb spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.37sec 0 299.98sec
li_lvb li_lvb spectral_blast 246442 5673805 18914 7.50 121869 248614 37.7 37.5 23.2% 0.0% 0.0% 0.0% 7.00sec 5673805 299.98sec
li_lvb li_lvb spectral_bolt 242571 12060162 40203 19.71 98655 201256 98.8 98.5 23.2% 0.0% 0.0% 0.0% 2.62sec 12060162 299.98sec
li_lvb li_lvb stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 299.98sec
li_lvb li_lvb totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.88sec 0 299.98sec
li_lvb li_lvb_primal_fire_elemental fire_blast 57984 25297664 136543 31.75 209436 418857 98.1 98.1 23.2% 0.0% 0.0% 0.0% 2.97sec 25297664 185.27sec
li_lvb li_lvb_greater_lightning_elemental lightning_blast 191726 7962367 186560 59.15 153657 307272 42.1 42.1 23.2% 0.0% 0.0% 0.0% 6.72sec 7962367 42.68sec
mb_lvs mb_lvs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
mb_lvs mb_lvs earth_shock 8042 31171015 103907 3.28 1342659 3717349 16.4 16.4 23.6% 0.0% 0.0% 0.0% 17.60sec 31171015 299.99sec
mb_lvs mb_lvs elemental_blast 117014 18088109 60296 4.41 582426 1611840 22.1 22.0 23.2% 0.0% 0.0% 0.0% 13.76sec 18088109 299.99sec
mb_lvs mb_lvs elemental_blast_overload 120588 9553725 31847 2.79 489231 1354338 14.0 13.9 22.7% 0.0% 0.0% 0.0% 21.01sec 9553725 299.99sec
mb_lvs mb_lvs fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.56sec 0 299.99sec
mb_lvs mb_lvs flame_shock 188389 2273229 7578 2.24 86434 243069 11.2 11.2 74.2% 0.0% 0.0% 0.0% 27.79sec 36178465 299.99sec
mb_lvs mb_lvs flame_shock ticks -188389 33905236 113017 47.25 47579 181667 11.2 236.2 71.6% 0.0% 0.0% 0.0% 27.79sec 36178465 299.99sec
mb_lvs mb_lvs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
mb_lvs mb_lvs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
mb_lvs mb_lvs frost_shock 196840 35434986 118120 7.67 652446 1807045 38.3 38.3 23.6% 0.0% 0.0% 0.0% 7.55sec 35434986 299.99sec
mb_lvs mb_lvs icefury 210714 10128881 33764 1.93 740452 2052186 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.15sec 10128881 299.99sec
mb_lvs mb_lvs icefury_overload 219271 5430279 18101 1.23 622260 1723978 6.2 6.2 23.4% 0.0% 0.0% 0.0% 46.39sec 5430279 299.99sec
mb_lvs mb_lvs lava_burst 51505 45965105 153222 11.78 0 780105 59.1 58.9 100.0% 0.0% 0.0% 0.0% 5.03sec 45965105 299.99sec
mb_lvs mb_lvs lava_burst_overload 77451 23393674 77981 7.49 0 624673 37.6 37.4 100.0% 0.0% 0.0% 0.0% 7.89sec 23393674 299.99sec
mb_lvs mb_lvs volcanic_inferno 205533 2433618 8112 8.78 44714 91211 43.9 43.9 23.1% 0.0% 0.0% 0.0% 6.14sec 2433618 299.99sec
mb_lvs mb_lvs lightning_bolt 188196 30892745 102979 19.23 227343 632423 96.1 96.1 23.2% 0.0% 0.0% 0.0% 3.04sec 30892745 299.99sec
mb_lvs mb_lvs lightning_bolt_overload 45284 25739663 85801 18.73 194197 539886 93.6 93.6 23.3% 0.0% 0.0% 0.0% 3.79sec 25739663 299.99sec
mb_lvs mb_lvs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
mb_lvs mb_lvs spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.39sec 0 299.99sec
mb_lvs mb_lvs spectral_blast 246442 5682229 18941 7.52 121869 248614 37.7 37.6 23.1% 0.0% 0.0% 0.0% 6.94sec 5682229 299.99sec
mb_lvs mb_lvs spectral_bolt 242571 12094784 40317 19.74 98655 201256 99.0 98.7 23.3% 0.0% 0.0% 0.0% 2.61sec 12094784 299.99sec
mb_lvs mb_lvs stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.57sec 0 299.99sec
mb_lvs mb_lvs totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.00sec 0 299.99sec
mb_lvs mb_lvs_primal_fire_elemental fire_blast 57984 25270969 136475 31.75 209439 418884 98.0 98.0 23.1% 0.0% 0.0% 0.0% 2.95sec 25270969 185.17sec
mb_lvs mb_lvs_greater_lightning_elemental lightning_blast 191726 7968995 186628 59.19 153613 307257 42.1 42.1 23.2% 0.0% 0.0% 0.0% 6.71sec 7968995 42.70sec
tgt_eq tgt_eq augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
tgt_eq tgt_eq earth_shock 8042 31052171 103508 3.28 1342678 3719035 16.4 16.4 23.2% 0.0% 0.0% 0.0% 17.64sec 31052171 300.00sec
tgt_eq tgt_eq elemental_blast 117014 18054395 60182 4.41 582483 1612153 22.1 22.0 23.0% 0.0% 0.0% 0.0% 13.76sec 18054395 300.00sec
tgt_eq tgt_eq elemental_blast_overload 120588 9542643 31809 2.78 489202 1354908 13.9 13.9 22.8% 0.0% 0.0% 0.0% 21.24sec 9542643 300.00sec
tgt_eq tgt_eq fire_elemental 198067 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 109.59sec 0 300.00sec
tgt_eq tgt_eq flame_shock 188389 2274055 7580 2.24 86394 243140 11.2 11.2 74.2% 0.0% 0.0% 0.0% 27.78sec 36209383 300.00sec
tgt_eq tgt_eq flame_shock ticks -188389 33935329 113118 47.27 47595 181655 11.2 236.3 71.6% 0.0% 0.0% 0.0% 27.78sec 36209383 300.00sec
tgt_eq tgt_eq flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
tgt_eq tgt_eq food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
tgt_eq tgt_eq frost_shock 196840 35403172 118011 7.66 652220 1807234 38.3 38.3 23.5% 0.0% 0.0% 0.0% 7.55sec 35403172 300.00sec
tgt_eq tgt_eq icefury 210714 10160549 33869 1.93 740334 2049688 9.7 9.7 23.8% 0.0% 0.0% 0.0% 32.15sec 10160549 300.00sec
tgt_eq tgt_eq icefury_overload 219271 5408539 18029 1.23 621804 1724162 6.1 6.1 23.6% 0.0% 0.0% 0.0% 46.91sec 5408539 300.00sec
tgt_eq tgt_eq lava_burst 51505 44955835 149854 11.79 0 762565 59.1 59.0 100.0% 0.0% 0.0% 0.0% 5.03sec 44955835 300.00sec
tgt_eq tgt_eq lava_burst_overload 77451 23110123 77034 7.50 0 616073 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.83sec 23110123 300.00sec
tgt_eq tgt_eq volcanic_inferno 205533 2451268 8171 8.84 44704 91205 44.2 44.2 23.2% 0.0% 0.0% 0.0% 6.18sec 2451268 300.00sec
tgt_eq tgt_eq lightning_bolt 188196 30945801 103153 19.24 227147 632705 96.2 96.2 23.3% 0.0% 0.0% 0.0% 3.04sec 30945801 300.00sec
tgt_eq tgt_eq lightning_bolt_overload 45284 25703063 85678 18.74 193996 539680 93.7 93.7 23.2% 0.0% 0.0% 0.0% 3.81sec 25703063 300.00sec
tgt_eq tgt_eq potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
tgt_eq tgt_eq spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.00sec
tgt_eq tgt_eq spectral_blast 246442 5680613 18936 7.51 121869 248614 37.7 37.5 23.3% 0.0% 0.0% 0.0% 6.98sec 5680613 300.00sec
tgt_eq tgt_eq spectral_bolt 242571 12056760 40190 19.69 98655 201256 98.7 98.4 23.2% 0.0% 0.0% 0.0% 2.62sec 12056760 300.00sec
tgt_eq tgt_eq stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.57sec 0 300.00sec
tgt_eq tgt_eq totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 112.93sec 0 300.00sec
tgt_eq tgt_eq_primal_fire_elemental fire_blast 57984 25286439 136530 31.77 209426 418874 98.1 98.1 23.1% 0.0% 0.0% 0.0% 2.96sec 25286439 185.21sec
tgt_eq tgt_eq_greater_lightning_elemental lightning_blast 191726 7955168 186570 59.09 153645 307339 42.0 42.0 23.3% 0.0% 0.0% 0.0% 6.71sec 7955168 42.64sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
1061221.9 1061221.9 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.03% 11.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.03%

Trigger Attempt Success

  • trigger_pct:98.82%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.84% 10.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.74% 10.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.74%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.32% 11.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 9.45% 9.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:9.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.47% 11.47% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.72% 10.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.31% 8.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.96% 5.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 1061221.92
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 102702
Mean 300.00
Minimum 239.94
Maximum 360.04
Spread ( max - min ) 120.10
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 35.9582
5th Percentile 245.83
95th Percentile 354.16
( 95th Percentile - 5th Percentile ) 108.34
Mean Distribution
Standard Deviation 0.1122
95.00% Confidence Intervall ( 299.78 - 300.22 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 552
0.1% Error 55189
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1104
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 102702
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 102702
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 102702
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 102702
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 102702
Mean 1086788.10
Minimum 928207.39
Maximum 1282818.12
Spread ( max - min ) 354610.73
Range [ ( max - min ) / 2 * 100% ] 16.31%
Standard Deviation 41219.8863
5th Percentile 1021908.76
95th Percentile 1157707.45
( 95th Percentile - 5th Percentile ) 135798.69
Mean Distribution
Standard Deviation 128.6226
95.00% Confidence Intervall ( 1086536.01 - 1087040.20 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5527
0.1 Scale Factor Error with Delta=300 14504316
0.05 Scale Factor Error with Delta=300 58017264
0.01 Scale Factor Error with Delta=300 1450431580
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 102702
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 102702
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 102702
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 102702
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 382980865 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.